CD21 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-38538

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 300-590 of human CD21 (NP_001006659.1).

Sequence:
IVTYTCDPDPEEGVNFILIGESTLRCTVDSQKTGTWSGPAPRCELSTSAVQCPHPQILRGRMVSGQKDRYTYNDTVIFACMFGFTLKGSKQIRCNAQGTWEPSAPVCEKECQAPPNILNGQKEDRHMVRFDPGTSIKYSCNPGYVLVGEESIQCTSEGVWTPPVPQCKVAACEATGRQLLTKPQHQFVRPDVNSSCGEGYKLSGSVYQECQGTIPWFMEIRLCKEITCPPPPVIYNGAHTGSSLEDFPYGTTVTYTCNPGPERGVEFSLIGESTIRCTSNDQERGTWSGPA

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

113 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for CD21 Antibody - BSA Free

CD21 Antibody

Immunohistochemistry: CD21 Antibody [NBP3-38538] -

Immunohistochemistry: CD21 Antibody [NBP3-38538] - Immunohistochemistry analysis of paraffin-embedded Rat spleen using CD21 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
CD21 Antibody

Immunocytochemistry/ Immunofluorescence: CD21 Antibody [NBP3-38538] -

Immunocytochemistry/ Immunofluorescence: CD21 Antibody [NBP3-38538] - Immunofluorescence analysis of paraffin-embedded human spleen using CD21 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
CD21 Antibody

Western Blot: CD21 Antibody [NBP3-38538] -

Western Blot: CD21 Antibody [NBP3-38538] - Western blot analysis of various lysates using CD21 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 60s.
CD21 Antibody

Immunocytochemistry/ Immunofluorescence: CD21 Antibody [NBP3-38538] -

Immunocytochemistry/ Immunofluorescence: CD21 Antibody [NBP3-38538] - Immunofluorescence analysis of paraffin-embedded mouse spleen using CD21 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
CD21 Antibody

Immunocytochemistry/ Immunofluorescence: CD21 Antibody [NBP3-38538] -

Immunocytochemistry/ Immunofluorescence: CD21 Antibody [NBP3-38538] - Immunofluorescence analysis of paraffin-embedded rat spleen using CD21 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for CD21 Antibody - BSA Free

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 μg/mL

Immunocytochemistry/ Immunofluorescence

1:50 - 1:100

Immunohistochemistry-Paraffin

1:50 - 1:100

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: CD21

CD21 (complement receptor 2, CR2) binds C3 complement fragments, especially its breakdown fragments, which remain covalently attached to complement activating surfaces or antigen. CD21 has important roles in uptake and retention of immunocomplexes, survival of memory B cells and in development and maintenance of the humoral response to T-dependent antigens. CD21 also serves as a key receptor for Epstein-Barr virus binding and is involved in targeting prions to folicular dendritic cells and expediting neuroinvasion following peripheral exposure to prions. A soluble form of the CD21 (sCD21) is shed from the lymphocyte surface and retains its ability to bind respective ligands.

Alternate Names

C3DR, CD21, CR2

Gene Symbol

CR2

Additional CD21 Products

Product Documents for CD21 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CD21 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CD21 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CD21 Antibody - BSA Free and earn rewards!

Have you used CD21 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...