CD3 zeta Antibody (1T5R7)

Novus Biologicals | Catalog # NBP3-15349

Recombinant Monoclonal Antibody
Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Flow Cytometry

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 1T5R7 expressed in HEK293
View all CD3 zeta/CD247 Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 65-164 of human CD3 zeta (P20963). QQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

19 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for CD3 zeta Antibody (1T5R7)

Western Blot: CD3 zeta Antibody (1T5R7) [NBP3-15349]

Western Blot: CD3 zeta Antibody (1T5R7) [NBP3-15349]

Western Blot: CD3 zeta Antibody (1T5R7) [NBP3-15349] - Western blot analysis of extracts of Jurkat cells, using CD3 zeta Rabbit mAb (NBP3-15349) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit. Exposure time: 3min.
CD3 zeta Antibody (1T5R7)

Immunohistochemistry: CD3 zeta Antibody (1T5R7) [CD3 zeta] -

Immunohistochemistry: CD3 zeta Antibody (1T5R7) [CD3 zeta] - Immunohistochemistry analysis of paraffin-embedded Human tonsil tissue using CD3 zeta Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
CD3 zeta Antibody (1T5R7)

Immunohistochemistry: CD3 zeta Antibody (1T5R7) [CD3 zeta] -

Immunohistochemistry: CD3 zeta Antibody (1T5R7) [CD3 zeta] - Immunohistochemistry analysis of paraffin-embedded Human esophagus tissue using CD3 zeta Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
CD3 zeta Antibody (1T5R7)

Flow Cytometry: CD3 zeta Antibody (1T5R7) [CD3 zeta] -

Flow Cytometry: CD3 zeta Antibody (1T5R7) [CD3 zeta] - Flow cytometry:1X10^6 Raji cells (negative control,left) and Jurkat cells were intracellularly-stained with CD3 zeta Rabbit mAb or Rabbit IgG isotype control,followed by FITC conjugated goat anti-rabbit pAb(1:200 dilution) staining. Non-fluorescently stained cells were used as blank control.

Applications for CD3 zeta Antibody (1T5R7)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.

Flow Cytometry

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Western Blot

1:1000 - 1:2000

Flow Cytometry Panel Builder

Bio-Techne Knows Flow Cytometry

Save time and reduce costly mistakes by quickly finding compatible reagents using the Panel Builder Tool.

Advanced Features

  • Spectra Viewer - Custom analysis of spectra from multiple fluorochromes
  • Spillover Popups - Visualize the spectra of individual fluorochromes
  • Antigen Density Selector - Match fluorochrome brightness with antigen density
Build Your Panel Now
Flow Cytometry

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: CD3 zeta/CD247

CD3 (Cluster of Differentiation 3) is a complex of proteins that associates directly with the T cell antigen receptor (TCR). Antigen binding to the TCR leads to IL-2 secretion via activation of a tyrosine phosphorylation pathway and a phospholipase C (PLC) pathway, in turn activating protein kinase C. CD3 is composed of five invariant polypeptide chains that associate to form three dimers. The five invariant chains of CD3 are labeled gamma, delta, epsilon, zeta, and eta. The zeta chain plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. Loss of the zeta chain results in the synthesis of unstable TCRs. A decrease of CD3 zeta has been described in T cells from patients with cancer, lupus and chronic infectious diseases.

Long Name

T-cell Receptor zeta

Alternate Names

CD247, CD3H, CD3Q, CD3Z, IMD25, T3Z, TCR Zeta Chain

Gene Symbol

CD247

Additional CD3 zeta/CD247 Products

Product Documents for CD3 zeta Antibody (1T5R7)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for CD3 zeta Antibody (1T5R7)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CD3 zeta Antibody (1T5R7)

There are currently no reviews for this product. Be the first to review CD3 zeta Antibody (1T5R7) and earn rewards!

Have you used CD3 zeta Antibody (1T5R7)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies