CD68/SR-D1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-48923

Novus Biologicals
Loading...

Key Product Details

Validated by

Knockout/Knockdown, Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Knockdown Validated

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This CD68/SR-D1 Antibody was developed against a recombinant protein corresponding to amino acids: SPTSKETIGDYTWTNGSQPCVHLQAQIQIRVMYTTQGGGEAWGISVLNPNKTKVQGSCEGAHPHLLLSFPYG

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for CD68/SR-D1 Antibody - BSA Free

Knockdown Validated: CD68/SR-D1 Antibody [NBP2-48923]

Western Blot: CD68/SR-D1 Antibody [NBP2-48923]

Western Blot: CD68/SR-D1 Antibody [NBP2-48923] - Analysis in U-87MG ATCC cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Immunohistochemistry-Paraffin: CD68/SR-D1 Antibody [NBP2-48923]

Immunohistochemistry-Paraffin: CD68/SR-D1 Antibody [NBP2-48923]

Immunohistochemistry-Paraffin: CD68/SR-D1 Antibody [NBP2-48923] - Immunohistochemical staining of human lung shows strong cytoplasmic positivity in macrophages.
Immunohistochemistry-Paraffin: CD68/SR-D1 Antibody [NBP2-48923]

Immunohistochemistry-Paraffin: CD68/SR-D1 Antibody [NBP2-48923]

Immunohistochemistry-Paraffin: CD68/SR-D1 Antibody [NBP2-48923] - Staining in human tonsil and skeletal muscle tissues. Corresponding CD68 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: CD68/SR-D1 Antibody [NBP2-48923]

Immunohistochemistry-Paraffin: CD68/SR-D1 Antibody [NBP2-48923]

Immunohistochemistry-Paraffin: CD68/SR-D1 Antibody [NBP2-48923] - Immunohistochemical staining of human tonsil shows strong cytoplasmic positivity in a subset of non-germinal center cells.
Immunohistochemistry-Paraffin: CD68/SR-D1 Antibody [NBP2-48923]

Immunohistochemistry-Paraffin: CD68/SR-D1 Antibody [NBP2-48923]

Immunohistochemistry-Paraffin: CD68/SR-D1 Antibody [NBP2-48923] - Immunohistochemical staining of human rectum shows strong cytoplasmic positivity in tissue macrophages.
Immunohistochemistry-Paraffin: CD68/SR-D1 Antibody [NBP2-48923]

Immunohistochemistry-Paraffin: CD68/SR-D1 Antibody [NBP2-48923]

Immunohistochemistry-Paraffin: CD68/SR-D1 Antibody [NBP2-48923] - Immunohistochemical staining of human skeletal muscle shows no positivity as expected.

Applications for CD68/SR-D1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:2500 - 1:5000

Immunohistochemistry-Paraffin

1:2500 - 1:5000

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CD68/SR-D1

Human CD68, also known as GP110, LAMP4, Scavenger Receptor D1 (SR-D1) or macrosialin in mouse, encodes a 110-kD transmembrane glycoprotein that belongs to the lysosomal/endosomal-associated membrane glycoprotein (LAMP) family. Members of the LAMP family include LAMP-1, LAMP-2, dendritic cell (DC)-LAMP (aka CD208), and brain and dendritic cell-associated (BAD)-LAMP (aka LAMP-5). Unlike the two LAMP domains facing the lysosomal lumen in LAMP-1 and LAMP-2, CD68 has a single LAMP domain containing four cystines spaced 36-37 residues apart along with an N-terminal Mucin-like domain. The 354 amino acid (a.a.) human CD68 and 326 a.a. murine ortholog share 80.6% a.a. sequence identity (1).

CD68 is highly expressed in cells of the mononuclear phagocyte system such as macrophages, microglia, osteoclasts, and myeloid dendritic cells (DCs); and is expressed to a lesser extent in lymphoid cells (CD19+ B lymphocytes and CD4+ T lymphocytes), human umbilical cord mesenchymal stem cells (MSCs), fibroblasts, endothelial cells, multiple non-hematopoietic cancer cell lines, and human arterial intimal smooth muscle cells (SMCs). Expression has been also observed in diseased states for granulocytes and neutrophils, in particular basophils from myeloproliferative disorders and intestinal neutrophils from inflammatory bowel disease (IBD), respectively (1).

Although the function of CD68 has yet to be established, it has often been used as an immunohistochemistry (IHC) marker of inflammation and for granular cell tumors (GCTs). CD68+ tumor associated macrophages (TAMs) has been suggested to be a predictive marker for poor cancer prognosis, but a meta-analysis showed the presence of CD68 is not correlated with survival (2). In addition, a role in hepatic malaria infection has been reported based on the finding that peptide P39 binds CD68, considered a receptor for malaria sporozoite, and inhibits parasite entry into Kupffer cells. CD68 was deemed a member of the Scavenger receptor family due to its upregulation in macrophages following inflammatory stimuli, ability to bind modified LDL, phosphatidylserine, and apoptotic cells, as well as shuttling between the plasma membrane and endosomes. CD68 has been linked to atherogenesis based on binding and internalization of its ligand, oxLDL (1).

References

1. Chistiakov, DA, Killingsworth, MC, Myasoedova, VA. Orekhov AN, Bobryshev YV. (2017) CD68/macrosialin: not just a histochemical marker. Lab Invest. 97:4-13. PMID: 27869795

2. Troiano G, Caponio VCA, Adipietro I, Tepedino M, Santoro R, Laino L, Lo Russo L, Cirillo N, Lo Muzio L. (2019) Prognostic significance of CD68+ and CD163+ tumor associated macrophages in head and neck squamous cell carcinoma: A systematic review and meta-analysis. Oral Oncol. 93:66-75. PMID: 31109698.

Alternate Names

CD68, gp110, Macrosialin, SCARD1, SR-D1, SRD1

Gene Symbol

CD68

Additional CD68/SR-D1 Products

Product Documents for CD68/SR-D1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CD68/SR-D1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for CD68/SR-D1 Antibody - BSA Free

Customer Reviews for CD68/SR-D1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CD68/SR-D1 Antibody - BSA Free and earn rewards!

Have you used CD68/SR-D1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies