CD99 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-82650

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: SSFIAYQKKKLCFKENAEQGEVDMESHRNANAEPAVQRTLL

Reactivity Notes

Reactivity reported in scientific literature (PMID: 22392539)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for CD99 Antibody - BSA Free

Western Blot: CD99 Antibody [NBP1-82650]

Western Blot: CD99 Antibody [NBP1-82650]

Western Blot: CD99 Antibody [NBP1-82650] - Analysis in control (vector only transfected HEK293T lysate) and CD99 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
CD99 Antibody - BSA Free Immunohistochemistry-Paraffin: CD99 Antibody [NBP1-82650]

Immunohistochemistry-Paraffin: CD99 Antibody [NBP1-82650]

Staining of human testis shows strong membranous positivity in cells in seminiferous ducts.
CD99 Antibody - BSA Free Immunohistochemistry-Paraffin: CD99 Antibody [NBP1-82650]

Immunohistochemistry-Paraffin: CD99 Antibody [NBP1-82650]

Staining of human pancreas shows strong membranous positivity in islets of Langerhans.
CD99 Antibody - BSA Free Immunohistochemistry-Paraffin: CD99 Antibody [NBP1-82650]

Immunohistochemistry-Paraffin: CD99 Antibody [NBP1-82650]

Staining of human placenta shows strong membranous positivity in endothelial cells.
CD99 Antibody - BSA Free Immunohistochemistry-Paraffin: CD99 Antibody [NBP1-82650]

Immunohistochemistry-Paraffin: CD99 Antibody [NBP1-82650]

Staining of human endometrium shows moderate membranous positivity in glandular cells.

Applications for CD99 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CD99

CD99 is encoded by this gene is a cell surface glycoprotein involved in leukocyte migration, T-cell adhesion, ganglioside GM1 and transmembrane protein transport, and T-cell death by a caspase-independent pathway. In addition, the encoded protein may have the ability to rearrange the actin cytoskeleton and may also act as an oncosuppressor in osteosarcoma. Cyclophilin A binds to CD99 and may act as a signaling regulator of CD99. This gene is found in the pseudoautosomal region of chromosomes X and Y and escapes X-chromosome inactivation. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Alternate Names

CD99, MIC2, pilr-1, PILR-L

Gene Symbol

CD99

Additional CD99 Products

Product Documents for CD99 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CD99 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for CD99 Antibody - BSA Free

Customer Reviews for CD99 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CD99 Antibody - BSA Free and earn rewards!

Have you used CD99 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...