CDC40 Antibody (2I8I7)

Novus Biologicals | Catalog # NBP3-15920

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 2I8I7 expressed in HEK293
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CDC40 (O60508). MSAAIAALAASYGSGSGSESDSDSESSRCPLPAADSLMHLTKSPSSKPSLAVAVDSAPEVAVKEDLETGVHLDPAVKEVQYNPTYETMFAPEFGPENPFR

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for CDC40 Antibody (2I8I7)

Western Blot: CDC40 Antibody (2I8I7) [NBP3-15920]

Western Blot: CDC40 Antibody (2I8I7) [NBP3-15920]

Western Blot: CDC40 Antibody (2I8I7) [NBP3-15920] - Western blot analysis of extracts of various cell lines, using CDC40 Rabbit mAb (NBP3-15920) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.
CDC40 Antibody (2I8I7)

Immunohistochemistry: CDC40 Antibody (2I8I7) [NBP3-15920] -

Immunohistochemistry: CDC40 Antibody (2I8I7) [NBP3-15920] - Immunohistochemistry analysis of CDC40 in paraffin-embedded human breast cancer tissue using CDC40 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
CDC40 Antibody (2I8I7)

Immunohistochemistry: CDC40 Antibody (2I8I7) [NBP3-15920] -

Immunohistochemistry: CDC40 Antibody (2I8I7) [NBP3-15920] - Immunohistochemistry analysis of CDC40 in paraffin-embedded human small intestine tissue using CDC40 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
CDC40 Antibody (2I8I7)

Immunohistochemistry: CDC40 Antibody (2I8I7) [NBP3-15920] -

Immunohistochemistry: CDC40 Antibody (2I8I7) [NBP3-15920] - Immunohistochemistry analysis of CDC40 in paraffin-embedded mouse brain tissue using CDC40 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
CDC40 Antibody (2I8I7)

Immunohistochemistry: CDC40 Antibody (2I8I7) [NBP3-15920] -

Immunohistochemistry: CDC40 Antibody (2I8I7) [NBP3-15920] - Immunohistochemistry analysis of CDC40 in paraffin-embedded rat testis tissue using CDC40 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
CDC40 Antibody (2I8I7)

Immunohistochemistry: CDC40 Antibody (2I8I7) [NBP3-15920] -

Immunohistochemistry: CDC40 Antibody (2I8I7) [NBP3-15920] - Immunohistochemistry analysis of CDC40 in paraffin-embedded rat kidney tissue using CDC40 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
CDC40 Antibody (2I8I7)

Immunohistochemistry: CDC40 Antibody (2I8I7) [NBP3-15920] -

Immunohistochemistry: CDC40 Antibody (2I8I7) [NBP3-15920] - Immunohistochemistry analysis of CDC40 in paraffin-embedded human spleen tissue using CDC40 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
CDC40 Antibody (2I8I7)

Immunohistochemistry: CDC40 Antibody (2I8I7) [NBP3-15920] -

Immunohistochemistry: CDC40 Antibody (2I8I7) [NBP3-15920] - Immunohistochemistry analysis of CDC40 in paraffin-embedded mouse testis tissue using CDC40 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
CDC40 Antibody (2I8I7)

Immunohistochemistry: CDC40 Antibody (2I8I7) [NBP3-15920] -

Immunohistochemistry: CDC40 Antibody (2I8I7) [NBP3-15920] - Immunohistochemistry analysis of CDC40 in paraffin-embedded mouse liver tissue using CDC40 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
CDC40 Antibody (2I8I7)

Immunohistochemistry: CDC40 Antibody (2I8I7) [NBP3-15920] -

Immunohistochemistry: CDC40 Antibody (2I8I7) [NBP3-15920] - Immunohistochemistry analysis of CDC40 in paraffin-embedded mouse colon tissue using CDC40 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
CDC40 Antibody (2I8I7)

Immunohistochemistry: CDC40 Antibody (2I8I7) [NBP3-15920] -

Immunohistochemistry: CDC40 Antibody (2I8I7) [NBP3-15920] - Immunohistochemistry analysis of CDC40 in paraffin-embedded rat lung tissue using CDC40 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
CDC40 Antibody (2I8I7)

Immunohistochemistry: CDC40 Antibody (2I8I7) [NBP3-15920] -

Immunohistochemistry: CDC40 Antibody (2I8I7) [NBP3-15920] - Immunohistochemistry analysis of CDC40 in paraffin-embedded rat colon tissue using CDC40 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Applications for CDC40 Antibody (2I8I7)

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:20-1:50

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: CDC40

Pre-mRNA splicing occurs in two sequential transesterification steps. The protein encoded by this gene is found to be essential for the catalytic step II in pre-mRNA splicing process. It is found in the spliceosome, and contains seven WD repeats, which function in protein-protein interactions. This protein has a sequence similarity to yeast Prp17 protein, which functions in two different cellular processes: pre-mRNA splicing and cell cycle progression. It suggests that this protein may play a role in cell cycle progression. [provided by RefSeq]

Alternate Names

Cell division cycle 40 homolog, cell division cycle 40 homolog (S. cerevisiae), cell division cycle 40 homolog (yeast), Ehb3, EH-binding protein 3, hPRP17, MGC102802, pre-mRNA splicing factor 17, pre-mRNA-processing factor 17, PRP17 homolog, PRP17EHB3PRPF17FLJ10564

Gene Symbol

CDC40

Additional CDC40 Products

Product Documents for CDC40 Antibody (2I8I7)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CDC40 Antibody (2I8I7)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CDC40 Antibody (2I8I7)

There are currently no reviews for this product. Be the first to review CDC40 Antibody (2I8I7) and earn rewards!

Have you used CDC40 Antibody (2I8I7)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...