CDK2 Antibody (10E0N5)

Novus Biologicals | Catalog # NBP3-33184

Novus Biologicals
Loading...

Key Product Details

Validated by

Knockout/Knockdown

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Monoclonal Rabbit IgG Clone # 10E0N5
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 199-298 of human CDK2 (P24941).

Sequence:
RRALFPGDSEIDQLFRIFRTLGTPDEVVWPGVTSMPDYKPSFPKWARQDFSKVVPPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for CDK2 Antibody (10E0N5)

CDK2 Antibody (10E0N5)

Western Blot: CDK2 Antibody (10E0N5) [NBP3-33184] -

Western Blot: CDK2 Antibody (10E0N5) [NBP3-33184] - Western blot analysis of various lysates using CDK2 Rabbit mAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 10s.
CDK2 Antibody (10E0N5)

Western Blot: CDK2 Antibody (10E0N5) [NBP3-33184] -

Western Blot: CDK2 Antibody (10E0N5) [NBP3-33184] - Western blot analysis of lysates from wild type(WT) and CDK2 knockout (KO) 293T cells, using [KO Validated] CDK2 Rabbit mAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 10s.

Applications for CDK2 Antibody (10E0N5)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.

Western Blot

1:1000 - 1:6000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: CDK2

The protein encoded by the Cdk2 gene is a member of the Ser/Thr protein kinase family. This protein kinase is highlysimilar to the gene products of S. cerevisiae cdc28, and S. pombe cdc2. It is a catalytic subunit of thecyclin-dependent protein kinase complex, whose activity is restricted to the G1-S phase, and essential for cell cycleG1/S phase transition. This protein associates with and regulated by the regulatory subunits of the complex includingcyclin A or E, CDK inhibitor p21Cip1 (CDKN1A) and p27Kip1 (CDKN1B). Its activity is also regulated by its proteinphosphorylation. Two alternatively spliced variants and multiple transcription initiation sites of this gene have beenreported. (provided by RefSeq)

Long Name

Cyclin-dependent Kinase 2

Alternate Names

cdc2-related protein kinase, cell devision kinase 2, Cell division protein kinase 2, cyclin-dependent kinase 2, EC 2.7.11, EC 2.7.11.22, p33 protein kinase, p33(CDK2)

Gene Symbol

CDK2

Additional CDK2 Products

Product Documents for CDK2 Antibody (10E0N5)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CDK2 Antibody (10E0N5)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for CDK2 Antibody (10E0N5)

There are currently no reviews for this product. Be the first to review CDK2 Antibody (10E0N5) and earn rewards!

Have you used CDK2 Antibody (10E0N5)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...

Associated Pathways

Akt Signaling Pathway
Akt Signaling Pathway Thumbnail