CDK4 Antibody (6N3M6)

Novus Biologicals | Catalog # NBP3-15344

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 6N3M6 expressed in HEK293
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 204-303 of human CDK4 (NP_000066.1). FAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for CDK4 Antibody (6N3M6)

Western Blot: CDK4 Antibody (6N3M6) [NBP3-15344]

Western Blot: CDK4 Antibody (6N3M6) [NBP3-15344]

Western Blot: CDK4 Antibody (3G7Q7) [NBP3-15344] - Western blot analysis of extracts of MCF7 cells, using CDK4 Rabbit mAb (NBP3-15344) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.
Immunocytochemistry/ Immunofluorescence: CDK4 Antibody (6N3M6) [NBP3-15344]

Immunocytochemistry/ Immunofluorescence: CDK4 Antibody (6N3M6) [NBP3-15344]

Immunocytochemistry/Immunofluorescence: CDK4 Antibody (3G7Q7) [NBP3-15344] - Immunofluorescence analysis of HeLa cells using CDK4 Rabbit mAb (NBP3-15344) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: CDK4 Antibody (6N3M6) [NBP3-15344]

Immunohistochemistry-Paraffin: CDK4 Antibody (6N3M6) [NBP3-15344]

Immunohistochemistry-Paraffin: CDK4 Antibody (3G7Q7) [NBP3-15344] - Immunohistochemistry of paraffin-embedded rat ovary using [KO Validated] CDK4 Rabbit mAb (NBP3-15344) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: CDK4 Antibody (6N3M6) [NBP3-15344]

Immunohistochemistry-Paraffin: CDK4 Antibody (6N3M6) [NBP3-15344]

Immunohistochemistry-Paraffin: CDK4 Antibody (3G7Q7) [NBP3-15344] - Immunohistochemistry of paraffin-embedded human breast cancer using [KO Validated] CDK4 Rabbit mAb (NBP3-15344) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: CDK4 Antibody (6N3M6) [NBP3-15344]

Immunohistochemistry-Paraffin: CDK4 Antibody (6N3M6) [NBP3-15344]

Immunohistochemistry-Paraffin: CDK4 Antibody (3G7Q7) [NBP3-15344] - Immunohistochemistry of paraffin-embedded human colon carcinoma using [KO Validated] CDK4 Rabbit mAb (NBP3-15344) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: CDK4 Antibody (6N3M6) [NBP3-15344]

Immunohistochemistry-Paraffin: CDK4 Antibody (6N3M6) [NBP3-15344]

Immunohistochemistry-Paraffin: CDK4 Antibody (3G7Q7) [NBP3-15344] - Immunohistochemistry of paraffin-embedded mouse lung using [KO Validated] CDK4 Rabbit mAb (NBP3-15344) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: CDK4 Antibody (6N3M6) [NBP3-15344]

Immunohistochemistry-Paraffin: CDK4 Antibody (6N3M6) [NBP3-15344]

Immunohistochemistry-Paraffin: CDK4 Antibody (3G7Q7) [NBP3-15344] - Immunohistochemistry of paraffin-embedded mouse spleen using [KO Validated] CDK4 Rabbit mAb (NBP3-15344) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: CDK4 Antibody (6N3M6) [NBP3-15344]

Immunohistochemistry-Paraffin: CDK4 Antibody (6N3M6) [NBP3-15344]

Immunohistochemistry-Paraffin: CDK4 Antibody (3G7Q7) [NBP3-15344] - Immunohistochemistry of paraffin-embedded rat lung using [KO Validated] CDK4 Rabbit mAb (NBP3-15344) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
CDK4 Antibody (6N3M6)

Western Blot: CDK4 Antibody (6N3M6) [CDK4] -

Western Blot: CDK4 Antibody (6N3M6) [CDK4] - Western blot analysis of various lysates, using CDK4 Rabbit mAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 10s.
CDK4 Antibody (6N3M6)

Immunohistochemistry: CDK4 Antibody (6N3M6) [CDK4] -

Immunohistochemistry: CDK4 Antibody (6N3M6) [CDK4] - Immunohistochemistry analysis of paraffin-embedded Human prostate tissue using [KO Validated] CDK4 Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
CDK4 Antibody (6N3M6)

Immunohistochemistry: CDK4 Antibody (6N3M6) [NBP3-15344] -

Immunohistochemistry: CDK4 Antibody (6N3M6) [NBP3-15344] - Immunohistochemistry analysis of paraffin-embedded Human tonsil tissue using [KO Validated] CDK4 Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
CDK4 Antibody (6N3M6)

Immunohistochemistry: CDK4 Antibody (6N3M6) [NBP3-15344] -

Immunohistochemistry: CDK4 Antibody (6N3M6) [NBP3-15344] - Immunohistochemistry analysis of paraffin-embedded Human cervix cancer tissue using [KO Validated] CDK4 Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
CDK4 Antibody (6N3M6)

Immunohistochemistry: CDK4 Antibody (6N3M6) [NBP3-15344] -

Immunohistochemistry: CDK4 Antibody (6N3M6) [NBP3-15344] - Immunohistochemistry analysis of paraffin-embedded Human cervix cancer tissue using [KO Validated] CDK4 Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
CDK4 Antibody (6N3M6)

Immunohistochemistry: CDK4 Antibody (6N3M6) [NBP3-15344] -

Immunohistochemistry: CDK4 Antibody (6N3M6) [NBP3-15344] - Immunohistochemistry analysis of paraffin-embedded Human breast cancer tissue using [KO Validated] CDK4 Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Applications for CDK4 Antibody (6N3M6)

Application
Recommended Usage

Immunohistochemistry

1:100 - 1:500

Immunohistochemistry-Paraffin

1:100 - 1:500

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: CDK4

Cdk4 is encoded by this gene is a member of the Ser/Thr protein kinase family. This protein is highly similar to the gene products of S. cerevisiae cdc28 and S. pombe cdc2. It is a catalytic subunit of the protein kinase complex that is important for cell cycle G1 phase progression. The activity of this kinase is restricted to the G1-S phase, which is controlled by the regulatory subunits D-type cyclins and CDK inhibitor p16(INK4a). This kinase was shown to be responsible for the phosphorylation of retinoblastoma gene product (Rb). Mutations in this gene as well as in its related proteins including D-type cyclins, p16(INK4a) and Rb were all found to be associated with tumorigenesis of a variety of cancers. Multiple polyadenylation sites of this gene have been reported.

Long Name

Cyclin-dependent Kinase 4

Alternate Names

CMM3, PSK-J3

Gene Symbol

CDK4

Additional CDK4 Products

Product Documents for CDK4 Antibody (6N3M6)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CDK4 Antibody (6N3M6)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for CDK4 Antibody (6N3M6)

There are currently no reviews for this product. Be the first to review CDK4 Antibody (6N3M6) and earn rewards!

Have you used CDK4 Antibody (6N3M6)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies