The caudal-type homeobox protein family of transcription factors are involved in early anteroposterior patterning by regulating members of the HOX gene family. CDX proteins contain a caudal-like activation domain and a DNA-binding homeodomain. CDX2 promotes intestinal patterning and development, while CDX4 regulates hematopoiesis and proliferation and differentiation of epithelial lining in the gut. Caudal homologs are associated with various diseases including cancers of the gut epithelium.
CDX4 Antibody (2H7) - Azide and BSA Free
Novus Biologicals | Catalog # H00001046-M11
Loading...
Key Product Details
Species Reactivity
Human, Mouse, Rat
Applications
Western Blot, ELISA
Label
Unconjugated
Antibody Source
Monoclonal Mouse IgG2a Kappa Clone # 2H7
Format
Azide and BSA Free
Loading...
Product Specifications
Immunogen
CDX4 (NP_005184, 202 a.a. ~ 284 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RKSELAVNLGLSERQVKIWFQNRRAKERKMIKKKISQFENSGGSVQSDSDSISPGELPNTFFTTPSAVRGFQPIEIQQVIVSE*
Reactivity Notes
Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.
Specificity
CDX4 (2H7)
Clonality
Monoclonal
Host
Mouse
Isotype
IgG2a Kappa
Description
Quality control test: Antibody Reactive Against Recombinant Protein.
Scientific Data Images for CDX4 Antibody (2H7) - Azide and BSA Free
Western Blot: CDX4 Antibody (2H7) [H00001046-M11]
Western Blot: CDX4 Antibody (2H7) [H00001046-M11] - Analysis of CDX4 expression in Raw 264.7 (Cat # L024V1).Western Blot: CDX4 Antibody (2H7) [H00001046-M11]
Western Blot: CDX4 Antibody (2H7) [H00001046-M11] - Analysis of CDX4 expression in PC-12 (Cat # L012V1).Western Blot: CDX4 Antibody (2H7) [H00001046-M11]
Western Blot: CDX4 Antibody (2H7) [H00001046-M11] - Analysis of CDX4 expression in Hela S3 NE (Cat # L013V3).Applications for CDX4 Antibody (2H7) - Azide and BSA Free
Application
Recommended Usage
Western Blot
1:500
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.
Formulation, Preparation, and Storage
Purification
IgG purified
Formulation
In 1x PBS, pH 7.4
Format
Azide and BSA Free
Preservative
No Preservative
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Background: CDX4
Long Name
Caudal-type Homeobox Transcription Factor 4
Alternate Names
caudal type homeo box transcription factor 4, caudal type homeobox 4, caudal type homeobox transcription factor 4, Caudal-type homeobox protein 4, homeobox protein CDX-4
Entrez Gene IDs
1046 (Human)
Gene Symbol
CDX4
OMIM
300025 (Human)
UniProt
Additional CDX4 Products
Product Documents for CDX4 Antibody (2H7) - Azide and BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for CDX4 Antibody (2H7) - Azide and BSA Free
This product is produced by and distributed for Abnova, a company based in Taiwan.
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Customer Reviews for CDX4 Antibody (2H7) - Azide and BSA Free
There are currently no reviews for this product. Be the first to review CDX4 Antibody (2H7) - Azide and BSA Free and earn rewards!
Have you used CDX4 Antibody (2H7) - Azide and BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- ELISA Sample Preparation & Collection Guide
- ELISA Troubleshooting Guide
- How to Run an R&D Systems DuoSet ELISA
- How to Run an R&D Systems Quantikine ELISA
- How to Run an R&D Systems Quantikine™ QuicKit™ ELISA
- Quantikine HS ELISA Kit Assay Principle, Alkaline Phosphatase
- Quantikine HS ELISA Kit Principle, Streptavidin-HRP Polymer
- R&D Systems Quality Control Western Blot Protocol
- Sandwich ELISA (Colorimetric) – Biotin/Streptavidin Detection Protocol
- Sandwich ELISA (Colorimetric) – Direct Detection Protocol
- Troubleshooting Guide: ELISA
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...