CDYL Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-34011

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: PVKSRTAVDGFQSESPEKLDPVEQGQEDTVAPEVAAEKPVGALLGPGAERARMGSRPRIHP

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for CDYL Antibody - BSA Free

Western Blot: CDYL Antibody [NBP2-34011]

Western Blot: CDYL Antibody [NBP2-34011]

Western Blot: CDYL Antibody [NBP2-34011] - Analysis in human cell line RPMI-8226.
Immunocytochemistry/ Immunofluorescence: CDYL Antibody [NBP2-34011]

Immunocytochemistry/ Immunofluorescence: CDYL Antibody [NBP2-34011]

Immunocytochemistry/Immunofluorescence: CDYL Antibody [NBP2-34011] - Immunofluorescent staining of human cell line U-2 OS shows localization to nuclear speckles.
Immunohistochemistry-Paraffin: CDYL Antibody [NBP2-34011]

Immunohistochemistry-Paraffin: CDYL Antibody [NBP2-34011]

Immunohistochemistry-Paraffin: CDYL Antibody [NBP2-34011] - Staining of human placenta shows moderate to strong nuclear positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: CDYL Antibody [NBP2-34011]

Immunohistochemistry-Paraffin: CDYL Antibody [NBP2-34011]

Immunohistochemistry-Paraffin: CDYL Antibody [NBP2-34011] - Analysis in human placenta and pancreas tissues. Corresponding CDYL RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: CDYL Antibody [NBP2-34011]

Immunohistochemistry-Paraffin: CDYL Antibody [NBP2-34011]

Immunohistochemistry-Paraffin: CDYL Antibody [NBP2-34011] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.
Immunohistochemistry-Paraffin: CDYL Antibody [NBP2-34011]

Immunohistochemistry-Paraffin: CDYL Antibody [NBP2-34011]

Immunohistochemistry-Paraffin: CDYL Antibody [NBP2-34011] - Staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: CDYL Antibody [NBP2-34011]

Immunohistochemistry-Paraffin: CDYL Antibody [NBP2-34011]

Immunohistochemistry-Paraffin: CDYL Antibody [NBP2-34011] - Staining of human cerebral cortex shows moderate to strong nuclear positivity in neurons and glial cells.

Applications for CDYL Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CDYL

Chromodomain Y is a primate-specific Y-chromosomal gene family expressed exclusively in the testis and implicated in infertility. Although the Y-linked genes are testis-specific, this autosomal gene is ubiquitously expressed. The Y-linked genes arose by retrotransposition of an mRNA from this gene, followed by amplification of the retroposed gene. Proteins encoded by this gene superfamily possess a chromodomain, a motif implicated in chromatin binding and gene suppression, and a catalytic domain believed to be involved in histone acetylation. Multiple proteins are encoded by transcript variants of this gene.

Alternate Names

CDYL1bA620A17.2 (chromodomain protein, Y chromosome-like), CDY-like, CDY-like, autosomal, chromodomain protein, Y chromosome-like, chromodomain protein, Y-like, chromodomain Y-like protein, DKFZp586C1622, EC 2.3.1.48, MGC131936, testis-specific chromodomain Y-like protein

Gene Symbol

CDYL

UniProt

Additional CDYL Products

Product Documents for CDYL Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CDYL Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CDYL Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CDYL Antibody - BSA Free and earn rewards!

Have you used CDYL Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...