CENPI Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-56364

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all CENPI Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to CENPI(centromere protein I) The peptide sequence was selected from the N terminal of CENPI. Peptide sequence SPQKRVKNVQAQNRTSQGSSSFQTTLSAWKVKQDPSNSKNISKHGQNNPV. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

87 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for CENPI Antibody - BSA Free

Western Blot: CENPI Antibody [NBP1-56364]

Western Blot: CENPI Antibody [NBP1-56364]

Western Blot: CENPI Antibody [NBP1-56364] - Reccomended Titration: 0.2 - 1 ug/ml ELISA Titer: 1:312500 Positive Control: MCF7 cell lysate CENPI is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells

Applications for CENPI Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CENPI

CENPI is involved in the response of gonadal tissues to follicle-stimulating hormone. The gene encoding CENPI is also a potential candidate for human X-linked disorders of gonadal development and gametogenesis. The product of this gene is involved in the response of gonadal tissues to follicle-stimulating hormone. This gene is also a potential candidate for human X-linked disorders of gonadal development and gametogenesis.

Alternate Names

CENP-IFSH primary response (LRPR1, rat) homolog 1, centromere protein I, Follicle-stimulating hormone primary response protein, FSH primary response 1, FSH primary response protein 1, FSHPRH1Mis6, ICEN19, Interphase centromere complex protein 19, Leucine-rich primary response protein 1, LRPR1FSH primary response (LRPR1 homolog, rat) 1, Mis6

Gene Symbol

CENPI

UniProt

Q92674 (Human)

Additional CENPI Products

Product Documents for CENPI Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for CENPI Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CENPI Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CENPI Antibody - BSA Free and earn rewards!

Have you used CENPI Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies