CENPN Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-79664

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptide directed towards the middle region of human CENPNThe immunogen for this antibody is CENPN. Peptide sequence SFKKILQRALKNVTVSFRETEENAVWIRIAWGTQYTKPNQYKPTYVVYYS. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

41 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for CENPN Antibody - BSA Free

Western Blot: CENPN Antibody [NBP1-79664]

Western Blot: CENPN Antibody [NBP1-79664]

Western Blot: CENPN Antibody [NBP1-79664] - Antibody Titration: 0.2-1 ug/ml Positive Control: Jurkat cell lysate
Immunocytochemistry/ Immunofluorescence: CENPN Antibody [NBP1-79664]

Immunocytochemistry/ Immunofluorescence: CENPN Antibody [NBP1-79664]

Immunocytochemistry/Immunofluorescence: CENPN Antibody [NBP1-79664] - Sample Type: MCF7, Primary Antibody Dilution: 4 ug/ml
Immunocytochemistry/ Immunofluorescence: CENPN Antibody [NBP1-79664]

Immunocytochemistry/ Immunofluorescence: CENPN Antibody [NBP1-79664]

Immunocytochemistry/Immunofluorescence: CENPN Antibody [NBP1-79664] - Sample Type : DNA/ACA
Immunocytochemistry/ Immunofluorescence: CENPN Antibody [NBP1-79664]

Immunocytochemistry/ Immunofluorescence: CENPN Antibody [NBP1-79664]

Immunocytochemistry/Immunofluorescence: CENPN Antibody [NBP1-79664] - HeLa Primary Antibody Dilution: 4 ug/ml Secondary Antibody : Anti-rabbit Alexa 546 Secondary Antibody Dilution: 2 ug/ml

Applications for CENPN Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:10-1:2000

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CENPN

The centromere is a specialized chromatin domain, present throughout the cell cycle, that acts as a platform on whichthe transient assembly of the kinetochore occurs during mitosis. All active centromeres are characterized by thepresence of long arrays of nucleosomes in which CENPA (MIM 117139) replaces histone H3 (see MIM 601128). CENPN is anadditional factor required for centromere assembly (Foltz et al., 2006 (PubMed 16622419)).(supplied by OMIM)

Alternate Names

BM039, C16orf60, CENP-N, centromere protein N, chromosome 16 open reading frame 60, FLJ13607, FLJ22660, ICEN32, Interphase centromere complex protein 32

Gene Symbol

CENPN

Additional CENPN Products

Product Documents for CENPN Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CENPN Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for CENPN Antibody - BSA Free

Customer Reviews for CENPN Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CENPN Antibody - BSA Free and earn rewards!

Have you used CENPN Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...