Centaurin beta 2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-84543

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: RVYEANVEKMGIKKPQPGQRQEKEAYIRAKYVERKFVDKYSISLSPPEQQKKFVSKSSEEKRLSISKFGPGD

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Centaurin beta 2 Antibody - BSA Free

Western Blot: Centaurin beta 2 Antibody [NBP1-84543]

Western Blot: Centaurin beta 2 Antibody [NBP1-84543]

Western Blot: Centaurin beta 2 Antibody [NBP1-84543] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4.
Immunohistochemistry-Paraffin: Centaurin beta 2 Antibody [NBP1-84543]

Immunohistochemistry-Paraffin: Centaurin beta 2 Antibody [NBP1-84543]

Immunohistochemistry-Paraffin: Centaurin beta 2 Antibody [NBP1-84543] - Staining of human urinary bladder shows strong cytoplasmic positivity in urothelial cells.

Applications for Centaurin beta 2 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Centaurin beta 2

Centaurin beta 1 and Centaurin beta 2 are recruited to platelet-derived growth factor-induced dorsal membrane ruffles in NIH 3T3 mouse fibroblasts, and overexpression inhibited ruffle formation. In vitro, Centaurin beta 1 and Centaurin beta 2 preferred ARF6 as substrate rather than ARF1 or ARF5, and the GAP activity of both Centaurins was dependent upon phosphatidylinositol 4,5-bisphosphate (PtdIns(4,5)P2). The isolated PH domain of mouse Centaurin beta 2 exhibits moderate affinity for PtdIns(3,5)P2, but it does not bind any other phosphoinositides tested, including PtdIns(4,5)P2. Mutation of a highly conserved arginine in both Centaurins result in lack of ARF-GAP activity. Overexpression in HeLa cells of either Centaurin blocks the formation of ARF6-dependent protrusions. Both Centaurins are also recruited to peripheral, tubular membranes, where activation of ARF6 occurs and allows membrane recycling back to the plasma membrane.

Alternate Names

Arf GAP with coiled coil, ANK repeat and PH domains 2, ArfGAP with coiled-coil, ankyrin repeat and PH domains 2, centaurin, beta 2, Centaurin-beta-2, CENTB2centaurin-beta-2, Cnt-b2, KIAA0041arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2

Gene Symbol

ACAP2

Additional Centaurin beta 2 Products

Product Documents for Centaurin beta 2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Centaurin beta 2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Centaurin beta 2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Centaurin beta 2 Antibody - BSA Free and earn rewards!

Have you used Centaurin beta 2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...