CHD3 Antibody (5E12) - Azide and BSA Free

Novus Biologicals | Catalog # H00001107-M01

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 5E12

Format

Azide and BSA Free
View all CHD3 Primary Antibodies »

Product Specifications

Immunogen

CHD3 (NP_001005273, 1654 a.a. ~ 1741 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KPLDGQEHRERPEGETGDLGKREDVKGDRELRPGPRDEPRSNGRREEKTEKPRFMFNIADGGFTELHTLWQNEERAAISSGKLNEIWH

Specificity

CHD3 - chromodomain helicase DNA binding protein 3

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Description

Quality control test: Antibody Reactive Against Recombinant Protein.

Scientific Data Images for CHD3 Antibody (5E12) - Azide and BSA Free

Immunohistochemistry-Paraffin: CHD3 Antibody (5E12) [H00001107-M01]

Immunohistochemistry-Paraffin: CHD3 Antibody (5E12) [H00001107-M01]

Immunohistochemistry-Paraffin: CHD3 Antibody (5E12) [H00001107-M01] - Analysis of monoclonal antibody to CHD3 on formalin-fixed paraffin-embedded human colon. Antibody concentration 3 ug/ml.

Applications for CHD3 Antibody (5E12) - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody reactivity against recombinant protein for WB. It has been used for IHC-P and ELISA.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: CHD3

This gene encodes a member of the CHD family of proteins which are characterized by the presence of chromo (chromatin organization modifier) domains and SNF2-related helicase/ATPase domains. This protein is one of the components of a histone deacetylase complex referred to as the Mi-2/NuRD complex which participates in the remodeling of chromatin by deacetylating histones. Chromatin remodeling is essential for many processes including transcription. Autoantibodies against this protein are found in a subset of patients with dermatomyositis. Three alternatively spliced transcripts encoding different isoforms have been described.

Alternate Names

ATP-dependent helicase CHD3, CHD-3, chromodomain helicase DNA binding protein 3, chromodomain-helicase-DNA-binding protein 3, EC 3.6.1, EC 3.6.4.12, hZFH, Mi-2 autoantigen 240 kDa protein, Mi-2a, Mi2-alpha, ZFH, Zinc finger helicase, zinc-finger helicase (Snf2-like)

Entrez Gene IDs

1107 (Human)

Gene Symbol

CHD3

OMIM

602120 (Human)

UniProt

NP_001005273 (Human)

Additional CHD3 Products

Product Documents for CHD3 Antibody (5E12) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for CHD3 Antibody (5E12) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CHD3 Antibody (5E12) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review CHD3 Antibody (5E12) - Azide and BSA Free and earn rewards!

Have you used CHD3 Antibody (5E12) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies