Chromogranin C Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-62693

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: NPVEEKIESQTQEEVRDSKENIEKNEQINDEMKRSGQLGIQEEDLRKESKDQLSDDVSKVIAYLKRLVNAAGSGRLQNGQNGERA

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Chromogranin C Antibody - BSA Free

Immunohistochemistry-Paraffin: Chromogranin C Antibody [NBP2-62693]

Immunohistochemistry-Paraffin: Chromogranin C Antibody [NBP2-62693]

Immunohistochemistry-Paraffin: Chromogranin C Antibody [NBP2-62693] - Staining of human cerebral cortex.
Immunohistochemistry-Paraffin: Chromogranin C Antibody [NBP2-62693]

Immunohistochemistry-Paraffin: Chromogranin C Antibody [NBP2-62693]

Immunohistochemistry-Paraffin: Chromogranin C Antibody [NBP2-62693] - Analysis in human adrenal gland and liver tissues using Anti-SCG2 antibody. Corresponding SCG2 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Chromogranin C Antibody [NBP2-62693]

Immunohistochemistry-Paraffin: Chromogranin C Antibody [NBP2-62693]

Immunohistochemistry-Paraffin: Chromogranin C Antibody [NBP2-62693] - Staining of human adrenal gland shows high expression.
Immunohistochemistry-Paraffin: Chromogranin C Antibody [NBP2-62693]

Immunohistochemistry-Paraffin: Chromogranin C Antibody [NBP2-62693]

Immunohistochemistry-Paraffin: Chromogranin C Antibody [NBP2-62693] - Staining of human anterior pituitary gland shows strong cytoplasmic positivity in endocrine cells.
Immunohistochemistry-Paraffin: Chromogranin C Antibody [NBP2-62693]

Immunohistochemistry-Paraffin: Chromogranin C Antibody [NBP2-62693]

Immunohistochemistry-Paraffin: Chromogranin C Antibody [NBP2-62693] - Staining of human liver shows low expression as expected.
Immunohistochemistry-Paraffin: Chromogranin C Antibody [NBP2-62693]

Immunohistochemistry-Paraffin: Chromogranin C Antibody [NBP2-62693]

Immunohistochemistry-Paraffin: Chromogranin C Antibody [NBP2-62693] - Staining of human adrenal gland, cerebral cortex, lymph node and pituitary gland using Anti-SCG2 antibody NBP2-62693 (A) shows similar protein distribution across tissues to independent antibody NBP1-85631 (B).
Immunohistochemistry-Paraffin: Chromogranin C Antibody [NBP2-62693]

Immunohistochemistry-Paraffin: Chromogranin C Antibody [NBP2-62693]

Immunohistochemistry-Paraffin: Chromogranin C Antibody [NBP2-62693] - Staining of human lymph node.

Applications for Chromogranin C Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:5000 - 1:10000

Immunohistochemistry-Paraffin

1:5000 - 1:10000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Chromogranin C

Chromogranin C is a member of the chromogranin/secretogranin family of neuroendocrine secretory proteins. Studies in rodents suggest that the full-length protein, secretogranin II, is involved in the packaging or sorting of peptide hormones and neuropeptides into secretory vesicles. The full-length protein is cleaved to produce the active peptide secretoneurin, which exerts chemotaxic effects on specific cell types, and EM66, whose function is unknown. [provided by RefSeq]

Alternate Names

CHCG, Chromogranin-C, EM66, SCG2, secretogranin IICHGCchromogranin-C, secretoneurin, SgIIsecretogranin-2, SN

Gene Symbol

SCG2

Additional Chromogranin C Products

Product Documents for Chromogranin C Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Chromogranin C Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Chromogranin C Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Chromogranin C Antibody - BSA Free and earn rewards!

Have you used Chromogranin C Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Chromogranin C Antibody - BSA Free

Showing  1 - 1 of 1 FAQ Showing All
  • Q: I need a Chromogranin C antibody to run some Western Blots on equine samples. Can you help me choose? I see two candidates on the website NBP1-56985 and NBP1-91628

    A: The two products for chromogranin C that are validated for equine samples on our site (NBP1-56985 and NBP1-91628) have been guaranteed based on homology. Below is the percent homology shared between the antibody immunogen and the horse protein sequence. NBP1-56985: immunogen is 100% homologous and NBP1-91628: immunogen is 92% homologous Based on this homology, NBP1-56985 will be your best choice. Since both products are covered by our guarantee, if you purchase either for use with your equine samples, and you are not able to detect the correct band, just contact us and we will see if there is any suggestion we can offer. If not, we can at that time offer a refund or replacement for your order.

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Antibodies
Loading...