CIAPIN1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-38247

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-312 of human CIAPIN1 (NP_064709.2).

Sequence:
MADFGISAGQFVAVVWDKSSPVEALKGLVDKLQALTGNEGRVSVENIKQLLQSAHKESSFDIILSGLVPGSTTLHSAEILAEIARILRPGGCLFLKEPVETAVDNNSKVKTASKLCSALTLSGLVEVKELQREPLTPEEVQSVREHLGHESDNLLFVQITGKKPNFEVGSSRQLKLSITKKSSPSVKPAVDPAAAKLWTLSANDMEDDSMDLIDSDELLDPEDLKKPDPASLRAASCGEGKKRKACKNCTCGLAEELEKEKSREQMSSQPKSACGNCYLGDAFRCASCPYLGMPAFKPGEKVLLSDSNLHDA

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for CIAPIN1 Antibody - BSA Free

CIAPIN1 Antibody

Western Blot: CIAPIN1 Antibody [NBP3-38247] -

Western Blot: CIAPIN1 Antibody [NBP3-38247] - Western blot analysis of various lysates using CIAPIN1 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 10s.
CIAPIN1 Antibody

Immunoprecipitation: CIAPIN1 Antibody [NBP3-38247] -

Immunoprecipitation: CIAPIN1 Antibody [NBP3-38247] - Immunoprecipitation analysis of 200 ug extracts of 293T cells, using 3 ug CIAPIN1 antibody. Western blot was performed from the immunoprecipitate using CIAPIN1 antibody at a dilution of 1:1000.
CIAPIN1 Antibody

Immunocytochemistry/ Immunofluorescence: CIAPIN1 Antibody [NBP3-38247] -

Immunocytochemistry/ Immunofluorescence: CIAPIN1 Antibody [NBP3-38247] - Immunofluorescence analysis of U2OS cells using CIAPIN1 Rabbit pAb. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for CIAPIN1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunoprecipitation

0.5ug - 4ug antibody for 200ug - 400ug extracts of whole cells

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: CIAPIN1

CIAPIN1 is a cytokine-induced inhibitor of apoptosis with no relation to apoptosis regulatory molecules of the BCL2 (MIM 151430) or CASP (see MIM 147678) families. Expression of CIAPIN1 is dependent on growth factor stimulation (Shibayama et al., 2004 [PubMed 14970183]).[supplied by OMIM]

Alternate Names

Anamorsin, cytokine induced apoptosis inhibitor 1, Cytokine-induced apoptosis inhibitor 1, DRE2, Fe-S cluster assembly protein DRE2 homolog, predicted protein of HQ0915,2810413N20Rik, PRO0915

Gene Symbol

CIAPIN1

Additional CIAPIN1 Products

Product Documents for CIAPIN1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CIAPIN1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CIAPIN1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CIAPIN1 Antibody - BSA Free and earn rewards!

Have you used CIAPIN1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...