CISD1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-92696

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Mouse, Rat

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all CISD1 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 29-108 of human CISD1 (NP_060934.1). LAYKRFYVKDHRNKAMINLHIQKDNPKIVHAFDMEDLGDKAVYCRCWRSKKFPFCDGAHTKHNEETGDNVGPLIIKKKET

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

12 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for CISD1 Antibody - BSA Free

CISD1 Antibody - BSA Free

Western Blot: CISD1 Antibody - BSA Free [NBP2-92696] -

Western Blot: CISD1 Antibody - BSA Free [NBP2-92696] - Western blot analysis of various lysates, using CISD1 antibody at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 1s.
CISD1 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: CISD1 Antibody - BSA Free [NBP2-92696] -

Immunocytochemistry/ Immunofluorescence: CISD1 Antibody - BSA Free [NBP2-92696] - Immunofluorescence analysis of NIH/3T3 cells using CISD1 Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
CISD1 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: CISD1 Antibody - BSA Free [NBP2-92696] -

Immunocytochemistry/ Immunofluorescence: CISD1 Antibody - BSA Free [NBP2-92696] - Immunofluorescence analysis of PC-12 cells using CISD1 Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Applications for CISD1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: CISD1

CISD1 is a member of the CDGSH domain-containing family and may play a role in the regulation of mitochondrial oxidative capacity (Wiley et al., 2007, 2007 [PubMed 17376863] [PubMed 17584744]).[supplied by OMIM]. Sequence Note: This RefSeq record was created from transcript and genomic sequence data because no single transcript was available for the full length of the gene. The extent of this transcript is supported by transcript alignments and orthologous data.

Alternate Names

C10orf70, CDGSH iron sulfur domain 1, CDGSH iron sulfur domain-containing protein 1, CDGSH iron-sulfur domain-containing protein 1, chromosome 10 open reading frame 70, MDS029, MGC14684, MitoNEET, ZCD1, zinc finger CDGSH-type domain 1, zinc finger, CDGSH-type domain 1

Gene Symbol

CISD1

Additional CISD1 Products

Product Documents for CISD1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for CISD1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for CISD1 Antibody - BSA Free

Customer Reviews for CISD1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CISD1 Antibody - BSA Free and earn rewards!

Have you used CISD1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies