Claudin-11 Antibody - BSA Free

Name: Claudin-11 Antibody - BSA Free
Brand: Novus Biologicals
SKU: NBP3-10304
Price: 389 USD
Availability: InStock

Novus Biologicals | Catalog # NBP3-10304

Submit a review

Product Documents

100% Guarantee

Product Specifications
Scientific Data
Applications
Preparation & Storage
Background
Product Documents
Specific Notices
Research Areas

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free

View all Claudin-11 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human Claudin-11 (NP_005593). Peptide sequence VSFGYSLYAGWIGAVLCLVGGCVILCCAGDAQAFGENRFYYTAGSSSPTH

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Claudin-11 Antibody - BSA Free

Immunohistochemistry-Paraffin: Claudin-11 Antibody [NBP3-10304]

Immunohistochemistry-Paraffin: Claudin-11 Antibody [NBP3-10304] - Immunohistochemcal analysis of formalin-fixed paraffin-embedded human brain, cortex, white matter tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.

Applications for Claudin-11 Antibody - BSA Free

Application

Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Claudin-11

Oligodendrocyte specific protein belongs is a major component of central nervous system myelin that is necessary for normal CNS function. The claudin superfamily consists of many structurally related proteins in humans. These proteins, which include claudin 1 through 18, and are located in both epithelial and endothelial cells in all tight junction bearing tissues. Claudins, which consist of four transmembrane domains and two extracellular loops, make up tight junction strands. There is growing evidence that the Claudin 11 protein determines the permeability between layers of myelin sheaths via focal adhesion and with its expression highly regulated during development, may play an important role in cellular proliferation and migration. In addition, the protein is a candidate autoantigen in the development of autoimmune demyelinating disease.

Alternate Names

Claudin11, CLDN11, OSP, OTM

Gene Symbol

CLDN11

Additional Claudin-11 Products

Product Documents for Claudin-11 Antibody - BSA Free

Download Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Claudin-11 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.