Claudin-8 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-59157

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Porcine

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to CLDN8 (claudin 8) The peptide sequence was selected from the C terminal of CLDN8. Peptide sequence IVGGALFCCVFCCNEKSSSYRYSIPSHRTTQKSYHTGKKSPSVYSRSQYV. The peptide sequence for this immunogen was taken from within the described region.

Reactivity Notes

Use in Porcine reported in scientific literature (PMID: 35336858).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Claudin-8 Antibody - BSA Free

Western Blot: Claudin-8 Antibody [NBP1-59157]

Western Blot: Claudin-8 Antibody [NBP1-59157]

Western Blot: Claudin-8 Antibody [NBP1-59157] - Sample Tissue: Human 293T Antibody Dilution: 1.0 ug/ml
Immunohistochemistry: Claudin-8 Antibody [NBP1-59157]

Immunohistochemistry: Claudin-8 Antibody [NBP1-59157]

Immunohistochemistry: Claudin-8 Antibody [NBP1-59157] - Human Intestine
Western Blot: Claudin-8 Antibody [NBP1-59157]

Western Blot: Claudin-8 Antibody [NBP1-59157]

Western Blot: Claudin-8 Antibody [NBP1-59157] - Claudin 8 Antibody [NBP1-59157] - HepG2 cell lysate, Antibody Titration: 0.5-1.0ug/ml
Immunohistochemistry-Paraffin: Claudin-8 Antibody [NBP1-59157]

Immunohistochemistry-Paraffin: Claudin-8 Antibody [NBP1-59157]

Immunohistochemistry-Paraffin: Claudin-8 Antibody [NBP1-59157] - Claudin 8 Antibody [NBP1-59157] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.
Claudin-8 Antibody - BSA Free

Western Blot: Claudin-8 Antibody - BSA Free [NBP1-59157] -

Interendothelial junction-associated genes in PMVECs are dysregulated upon interaction with HP-PRRSV-infected PAMs. RNA-seq data in fragments per kilobase million (FPKM) for four TJ genes, including CLDN1 (A), CLDN4 (B), CLDN8 (C), and OCLN (D), for comparison are presented. (E) Western blot analysis of CLDN1, CLDN4, CLDN8, and OCLN in co-cultured PMVECs at the indicated time points post inoculation. beta -actin served as a loading control. The data are shown as means +/- SD (standard deviation), n = 3 independent experiments. Asterisks indicate statistical significance (***, p < 0.001). Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/35336858), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for Claudin-8 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Paraffin

1:10-1:500

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Claudin-8

CLDN8, clustered with CLDN17 at human chromosome 21q22.11, is a four-transmembrane protein with WWCC motif, defined by W-X(17-22)-W-X(2)-C-X(8-10)-C.

Alternate Names

Claudin8, CLDN8

Gene Symbol

CLDN8

UniProt

Additional Claudin-8 Products

Product Documents for Claudin-8 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Claudin-8 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Claudin-8 Antibody - BSA Free

Customer Reviews for Claudin-8 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Claudin-8 Antibody - BSA Free and earn rewards!

Have you used Claudin-8 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies