CLCN3 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-91790
Loading...
Key Product Details
Species Reactivity
Validated:
Human, Mouse, Rat
Cited:
Human
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot
Cited:
Western Blot, Immunoprecipitation
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: NSITSASSDEELLDGAGVIMDFQTSEDDNLLDGDTAVGTHYTMTNGGSINSSTHLLDLLDEP
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for CLCN3 Antibody - BSA Free
Immunohistochemistry-Paraffin: CLCN3 Antibody [NBP1-91790]
Immunohistochemistry-Paraffin: CLCN3 Antibody [NBP1-91790] - Staining of human hippocampus shows moderate cytoplasmic positivity in neuronal cells.Western Blot: CLCN3 Antibody [NBP1-91790]
Western Blot: CLCN3 Antibody [NBP1-91790] - Lane 1: Mouse liver tissue lysate Lane 2: Rat liver tissue lysate. Recommended dilution: 1:250 - 1:500Western Blot: CLCN3 Antibody - BSA Free [NBP1-91790]
Lane 1: Mouse liver tissue lysateLane 2: Rat liver tissue lysate
Western Blot: CLCN3 Antibody - BSA Free [NBP1-91790]
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Lane 4: Human plasma (IgG/HSA depleted)
Lane 5: Human liver tissue
Western Blot: CLCN3 Antibody - BSA Free [NBP1-91790] -
CLCN3 was upregulated in human LUAD and facilitated tumor proliferation and migration. (a, b) Through IHC and IF analysis, the expression of CLCN3 was examined in a tissue microarray of 30 paraffin-embedded LUAD tissues and adjacent normal tissues (ANT) (n = 30). (c, d) In human LUAD cell lines as well as in human bronchial epithelial cell lines, the basic protein expression of CLCN3 was measured (n = 3). (e) The basic RNA level of CLCN3 was detected in human LUAD cell lines and a human bronchial epithelial cell line (n = 3). (f) The protein expression of CLCN3 was inhibited after CLCN3 knockdown in H1299 and A549 cells. (g) RNA-seq was constructed after CLCN3 knockdown in H1299 cells. Locomotion and growth were significantly enriched as illustrated by GO analysis. (h) Knockdown of CLCN3 suppressed the clonogenicity of H1299 and A549 cells (n = 3). (i) CLCN3 knockdown suppressed the invasion of H1299 and A549 cells (n = 3). *P < 0.05. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/36439880), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: CLCN3 Antibody - BSA Free [NBP1-91790] -
HNRNPK knockdown inhibited the expression and function of CLCN3 in vitro. (a) The expression of CLCN3 was inhibited after HNRNPK knockdown but this inhibition was abrogated by CLCN3 upregulation. (b) Following HNRNPK knockdown, there was a decrease in the proliferation of LUAD cells, however, this decrease was restored by the upregulation of CLCN3 (n = 3). (c) The representative cell images showed that HNRNPK knockdown inhibited the cell proliferation at 24 h and was rescued by CLCN3 overexpression. (d) Cell clonogenicity was alleviated as a result of HNRNPK knockdown, and this reduction was restored by the upregulation of CLCN3 (n = 3). (e) The cell invasion was suppressed following HNRNPK knockdown, and this inhibition was rescued by CLCN3 upregulation (n = 3). *P < 0.05. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/36439880), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: CLCN3 Antibody - BSA Free [NBP1-91790] -
CLCN3 and HNRNPK were upregulated in LUAD and correlated with poor prognosis. (a, b) In paraffin-embedded LUAD tissue microarray, we discovered that the expression of CLCN3 and HNRNPK was elevated in LUAD tissues compared with ANT (n = 30). (c) The CLCN3 expression positively correlated with HNRNPK expression in LUAD tissues. (d) Using IF staining of LUAD tissue microarray, we found that both CLCN3 and HNRNPK were highly expressed in LUAD tissues (n = 30). (e) The Kaplan-Meier survival analysis illustrated that elevated CLCN3 or HNRNPK expression levels in tumors predicted a dismal prognosis for LUAD patients. In the HPA database, the data also suggested that the patients having an elevated expression of CLCN3 or HNRNPK exhibited a shorter overall survival. (f) LUAD and adjacent normal tissues were collected (16 cases), and the increased expression of CLCN3 or HNRNPK was confirmed in LUAD tissues (n = 16). (g) Correlation analysis indicated a positive expression correlation between CLCN3 and HNRNPK in 16 cases of LUAD tissues. *P < 0.05. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/36439880), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Knockdown Validated: CLCN3 Antibody - BSA Free [NBP1-91790] -
CLCN3 was upregulated in human LUAD and facilitated tumor proliferation and migration. (a, b) Through IHC and IF analysis, the expression of CLCN3 was examined in a tissue microarray of 30 paraffin-embedded LUAD tissues and adjacent normal tissues (ANT) (n = 30). (c, d) In human LUAD cell lines as well as in human bronchial epithelial cell lines, the basic protein expression of CLCN3 was measured (n = 3). (e) The basic RNA level of CLCN3 was detected in human LUAD cell lines and a human bronchial epithelial cell line (n = 3). (f) The protein expression of CLCN3 was inhibited after CLCN3 knockdown in H1299 and A549 cells. (g) RNA-seq was constructed after CLCN3 knockdown in H1299 cells. Locomotion and growth were significantly enriched as illustrated by GO analysis. (h) Knockdown of CLCN3 suppressed the clonogenicity of H1299 and A549 cells (n = 3). (i) CLCN3 knockdown suppressed the invasion of H1299 and A549 cells (n = 3). *P < 0.05. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/36439880), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Knockdown Validated: CLCN3 Antibody - BSA Free [NBP1-91790] -
HNRNPK/CLCN3 axis facilitated LUAD progression through interaction between tumor cells and CAFs. (a) Primary human CAFs and paired NFs were extracted from fresh LUAD samples. The expression of CAF markers was increased in CAFs compared to NFs, which was in accord with the typical characteristic of CAFs. (b) The levels of CLCN3 were detected in the culture supernatants of LUAD cells, and the data indicated that decreased extracellular CLCN3 secretion could be induced by HNRNPK knockdown. (c-e) The supernatants (HNRNPK knockdown and control) of LUAD cells were incubated with CAFs for 24 h. We confirmed that the PI3K-AKT signaling pathway was significantly enriched in CAFs. (f) The levels of p-AKT, alpha -SMA, FAP, and COL1A1 were decreased when CAFs were stimulated with the supernatants of HNRNPK-knockdown cells. After CLCN3 knockdown in CAFs, the levels of p-AKT, alpha -SMA, FAP, and COL1A1 were also effectively inhibited. (g) Due to the activation inhibition, the CAFs co-cultured with HNRNPK-knockdown LUAD cells were then considered as inhibited CAFs. The analysis by ELISA revealed that the TGF-beta 1 production of inhibited CAFs was significantly decreased (n = 7). (h) The supernatants of inhibited CAFs attenuated the expression of HNRNPK protein in the H1299 nucleus, and the attenuation effect was reversed after TGF-beta 1 treatment. (i) The supernatants of inhibited CAFs attenuated the fluorescence intensity of HNRNPK in the H1299 nucleus, which was also reversed after the addition of exogenous TGF-beta 1. (j, k) The supernatants of inhibited CAFs markedly attenuated the clonogenicity and invasion of LUAD cells, and this phenomenon was further reversed after the addition of TGF-beta 1 (n = 3). *P < 0.05. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/36439880), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for CLCN3 Antibody - BSA Free
Application
Recommended Usage
Immunohistochemistry
1:500 - 1:1000
Immunohistochemistry-Paraffin
1:500 - 1:1000
Western Blot
0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: CLCN3
Alternate Names
chloride channel 3, Chloride channel protein 3, Chloride transporter ClC-3, CLC3, ClC-3, H(+)/Cl(-) exchange transporter 3
Gene Symbol
CLCN3
Additional CLCN3 Products
Product Documents for CLCN3 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for CLCN3 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for CLCN3 Antibody - BSA Free
Customer Reviews for CLCN3 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review CLCN3 Antibody - BSA Free and earn rewards!
Have you used CLCN3 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...