CLTB Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-55390

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all CLTB Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ENDEGFGAPAGSHAAPAQPGPTSGAGSEDMGTTVNGDVFQEANGPADGYAAIAQADRLTQEPESIR

Reactivity Notes

Mouse 88%, Rat 88%

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for CLTB Antibody - BSA Free

Western Blot: CLTB Antibody [NBP2-55390]

Western Blot: CLTB Antibody [NBP2-55390]

Western Blot: CLTB Antibody [NBP2-55390] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Immunocytochemistry/ Immunofluorescence: CLTB Antibody [NBP2-55390]

Immunocytochemistry/ Immunofluorescence: CLTB Antibody [NBP2-55390]

Immunocytochemistry/Immunofluorescence: CLTB Antibody [NBP2-55390] - Staining of human cell line A-431 shows localization to plasma membrane, cytosol & vesicles.
Western Blot: CLTB Antibody [NBP2-55390]

Western Blot: CLTB Antibody [NBP2-55390]

Western Blot: CLTB Antibody [NBP2-55390] - Analysis in human cell line MCF-7 and human cell line RT-4.

Applications for CLTB Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CLTB

Clathrin is a large, soluble protein composed of heavy and light chains. It functions as the main structural component of the lattice-type cytoplasmic face of coated pits and vesicles which entrap specific macromolecules during receptor-mediated endocytosis. This gene encodes one of two clathrin light chain proteins which are believed to function as regulatory elements. Alternative splicing results in multiple transcript variants.

Alternate Names

clathrin light chain B, clathrin, light chain (Lcb), clathrin, light chain B, clathrin, light polypeptide (Lcb), Lcb

Gene Symbol

CLTB

Additional CLTB Products

Product Documents for CLTB Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for CLTB Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CLTB Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CLTB Antibody - BSA Free and earn rewards!

Have you used CLTB Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies