CNBP Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-55690

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (100%), Rat (100%). Backed by our 100% Guarantee.

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all CNBP Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GMRSRGRGGFTSDRGFQFVSSSLPDICYRCGESG

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for CNBP Antibody - BSA Free

Western Blot: CNBP Antibody [NBP2-55690]

Western Blot: CNBP Antibody [NBP2-55690]

Western Blot: CNBP Antibody [NBP2-55690] - Analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Immunocytochemistry/ Immunofluorescence: CNBP Antibody [NBP2-55690]

Immunocytochemistry/ Immunofluorescence: CNBP Antibody [NBP2-55690]

Immunocytochemistry/Immunofluorescence: CNBP Antibody [NBP2-55690] - Staining of human cell line SH-SY5Y shows localization to nucleus & cytosol. Antibody staining is shown in green.

Applications for CNBP Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CNBP

The ZNF9 protein contains 7 zinc finger domains and is believed to function as an RNA-binding protein. A CCTG expansion in intron 1 of the ZNF9 gene results in myotonic dystrophy type 2 (MIM 602668).[supplied by OMIM]

Alternate Names

CCHC-type zinc finger, nucleic acid binding protein, cellular nucleic acid binding protein, cellular nucleic acid-binding protein, DM2, erythroid differentiation-related, FLJ11631, PROMM, RNF163CNBP1ZNF9ZCCHC22, sterol regulatory element-binding protein, zinc finger protein 273, Zinc finger protein 9, zinc finger protein 9 (a cellular retroviral nucleic acid binding protein)

Gene Symbol

CNBP

Additional CNBP Products

Product Documents for CNBP Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for CNBP Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CNBP Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CNBP Antibody - BSA Free and earn rewards!

Have you used CNBP Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies