Collagen III alpha 1/COL3A1 Antibody (6Y9C6)

Novus Biologicals | Catalog # NBP3-15309

Recombinant Monoclonal Antibody
Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 6Y9C6 expressed in HEK293
View all Collagen III alpha 1/COL3A1 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 150-400 of human Collagen III alpha 1/COL3A1 (P02461). NYSPQYDSYDVKSGVAVGGLAGYPGPAGPPGPPGPPGTSGHPGSPGSPGYQGPPGEPGQAGPSGPPGPPGAIGPSGPAGKDGESGRPGRPGERGLPGPPGIKGPAGIPGFPGMKGHRGFDGRNGEKGETGAPGLKGENGLPGENGAPGPMGPRGAPGERGRPGLPGAAGARGNDGARGSDGQPGPPGPPGTAGFPGSPGAKGEVGPAGSPGSNGAPGQRGEPGPQGHAGAQGPPGPPGINGSPGGKGEMGP

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Collagen III alpha 1/COL3A1 Antibody (6Y9C6)

Western Blot: Collagen III alpha 1/COL3A1 Antibody (6Y9C6) [NBP3-15309]

Western Blot: Collagen III alpha 1/COL3A1 Antibody (6Y9C6) [NBP3-15309]

Western Blot: Collagen III alpha 1/COL3A1 Antibody (6Y9C6) [NBP3-15309] - Western blot analysis of extracts of various cell lines, using Collagen III alpha 1/COL3A1 antibody (NBP3-15309) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 60s.
Immunocytochemistry/ Immunofluorescence: Collagen III alpha 1/COL3A1 Antibody (6Y9C6) [NBP3-15309]

Immunocytochemistry/ Immunofluorescence: Collagen III alpha 1/COL3A1 Antibody (6Y9C6) [NBP3-15309]

Immunocytochemistry/Immunofluorescence: Collagen III alpha 1/COL3A1 Antibody (6Y9C6) [NBP3-15309] - Immunofluorescence analysis of NIH/3T3 cells using Collagen III alpha 1/COL3A1 antibody (NBP3-15309) at dilution of 1:100. Blue: DAPI for nuclear staining.
Western Blot: Collagen III alpha 1/COL3A1 Antibody (6Y9C6) [NBP3-15309]

Western Blot: Collagen III alpha 1/COL3A1 Antibody (6Y9C6) [NBP3-15309]

Western Blot: Collagen III alpha 1/COL3A1 Antibody (6Y9C6) [NBP3-15309] - Western blot analysis of extracts of various cell lines, using Collagen III alpha 1/COL3A1 antibody (NBP3-15309) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.
Immunocytochemistry/ Immunofluorescence: Collagen III alpha 1/COL3A1 Antibody (6Y9C6) [NBP3-15309]

Immunocytochemistry/ Immunofluorescence: Collagen III alpha 1/COL3A1 Antibody (6Y9C6) [NBP3-15309]

Immunocytochemistry/Immunofluorescence: Collagen III alpha 1/COL3A1 Antibody (6Y9C6) [NBP3-15309] - Immunofluorescence analysis of RD cells using Collagen III alpha 1/COL3A1 antibody (NBP3-15309) at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunoprecipitation: Collagen III alpha 1/COL3A1 Antibody (6Y9C6) [NBP3-15309]

Immunoprecipitation: Collagen III alpha 1/COL3A1 Antibody (6Y9C6) [NBP3-15309]

Immunoprecipitation: Collagen III alpha 1/COL3A1 Antibody (6Y9C6) [NBP3-15309] - Immunoprecipitation analysis of 300ug extracts of HepG2 cells using 3ug Collagen III alpha 1/COL3A1 antibody (NBP3-15309). Western blot was performed from the immunoprecipitate using Collagen III alpha 1/COL3A1 antibody (NBP3-15309) at a dilition of 1:1000.
Collagen III alpha 1/COL3A1 Antibody (6Y9C6)

Immunocytochemistry/ Immunofluorescence: Collagen III alpha 1/COL3A1 Antibody (6Y9C6) [Collagen III alpha 1/COL3A1] -

Immunocytochemistry/ Immunofluorescence: Collagen III alpha 1/COL3A1 Antibody (6Y9C6) [Collagen III alpha 1/COL3A1] - Confocal imaging of HeLa cells using Collagen III alpha 1/COL3A1 Rabbit mAb. The cells were counterstained with alpha-Tubulin Mouse mAb (Green). DAPI was used for nuclear staining (blue). Objective: 100x.

Applications for Collagen III alpha 1/COL3A1 Antibody (6Y9C6)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunoprecipitation

1:500 - 1:1000

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Collagen III alpha 1/COL3A1

Collagen III alpha 1, also referred to as collagen type III alpha 1 or COL3A1 for short, was first described in 1971 and is a member of the collagen superfamily and encoded COL3A1 gene (1, 2). In general, collagen III is an extracellular matrix protein that is synthesized as a preprocollagen followed by cleaving of the signal peptide to form the procollagen (1). The human COL3A1 gene is located on chromosome 2q32.2 and collagen III is synthesized as a homotrimer consisting of three identical alpha procollagen chains which are stabilized by disulfide bonds (1,2,3). Each alpha chain is 1466 amino acids (aa) in length with a theoretical molecular weight of 139 kDa for a single alpha chain (1). Structurally, each alpha chain is a left-handed helix which then join together to form a right-handed triple helix (1,2). C-terminal and N-terminal proteinases remove the globular ends of the procollagen to form the type III collagen (1).

Collagen III is a fibrillar collagen that constitutes 5-20% of all collagen in the body (1). It provides structural integrity and is found in many hallow organs and soft connective tissue including the vascular system, skin, lung, uterus, and intestine (1,2). Additionally, collagen III has be found to be associated with type I collagen in the same fibrils (1). Collagen III interacts with signaling integrins to carry out other key functions including cell adhesion, proliferation, and differentiation (1).

Mutations in the COL3A1 gene has been associated with a variety of human diseases, the most well-known being a group of connective tissue disorders termed Ehlers-Danlos Syndromes (1,2,4). Vascular Ehlers-Danlos Syndrome is a specific subtype that is considered the most severe and although the clinical manifestations vary, symptoms include thin skin and fragile blood vessels and can often result in both lung and heart complications (1,4). COL3A1 is also associated with glomerulopathies, or diseases of the glomeruli, which are characterized by an abundance of extracellular matrix (3). Collagenofibrotic glomerulopathy is one specific rare renal disease that is characterized by excessive levels of collagen III (3).

References

1. Kuivaniemi, H., & Tromp, G. (2019). Type III collagen (COL3A1): Gene and protein structure, tissue distribution, and associated diseases. Gene. https://doi.org/10.1016/j.gene.2019.05.003

2. Ricard-Blum S. (2011). The collagen family. Cold Spring Harbor perspectives in biology. https://doi.org/10.1101/cshperspect.a004978

3. Cohen A. H. (2012). Collagen Type III Glomerulopathies. Advances in chronic kidney disease. https://doi.org/10.1053/j.ackd.2012.02.017

4. Olson, S. L., Murray, M. L., & Skeik, N. (2019). A Novel Frameshift COL3A1 Variant in Vascular Ehlers-Danlos Syndrome. Annals of vascular surgery. https://doi.org/10.1016/j.avsg.2019.05.057

Alternate Names

COL3A1, EDS4A

Gene Symbol

COL3A1

Additional Collagen III alpha 1/COL3A1 Products

Product Documents for Collagen III alpha 1/COL3A1 Antibody (6Y9C6)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Collagen III alpha 1/COL3A1 Antibody (6Y9C6)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Extracellular Matrix Molecules

Customer Reviews for Collagen III alpha 1/COL3A1 Antibody (6Y9C6)

There are currently no reviews for this product. Be the first to review Collagen III alpha 1/COL3A1 Antibody (6Y9C6) and earn rewards!

Have you used Collagen III alpha 1/COL3A1 Antibody (6Y9C6)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies