Collagen VI alpha 1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-91193

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Predicted:

Mouse (95%), Rat (93%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: VKVFSVAITPDHLEPRLSIIATDHTYRRNFTAADWGQSRDAEEAISQTIDTIVDMIKNNVEQVCCSFECQPAR

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Collagen VI alpha 1 Antibody - BSA Free

Immunohistochemistry-Paraffin: Collagen VI alpha 1 Antibody [NBP1-91193]

Immunohistochemistry-Paraffin: Collagen VI alpha 1 Antibody [NBP1-91193]

Immunohistochemistry-Paraffin: Collagen VI alpha 1 Antibody [NBP1-91193] - Staining of human placenta shows moderate positivity in extracellular matrix.
Immunohistochemistry-Paraffin: Collagen VI alpha 1 Antibody [NBP1-91193]

Immunohistochemistry-Paraffin: Collagen VI alpha 1 Antibody [NBP1-91193]

Immunohistochemistry-Paraffin: Collagen VI alpha 1 Antibody [NBP1-91193] - Analysis in human placenta and pancreas tissues. Corresponding COL6A1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Collagen VI alpha 1 Antibody [NBP1-91193]

Immunohistochemistry-Paraffin: Collagen VI alpha 1 Antibody [NBP1-91193]

Immunohistochemistry-Paraffin: Collagen VI alpha 1 Antibody [NBP1-91193] - Staining of human testis shows weak positivity in extracellular matrix in peritubular myoid cells.
Immunohistochemistry-Paraffin: Collagen VI alpha 1 Antibody [NBP1-91193]

Immunohistochemistry-Paraffin: Collagen VI alpha 1 Antibody [NBP1-91193]

Immunohistochemistry-Paraffin: Collagen VI alpha 1 Antibody [NBP1-91193] - Staining of human skin shows moderate positivity in extracellular matrix.
Immunohistochemistry-Paraffin: Collagen VI alpha 1 Antibody [NBP1-91193]

Immunohistochemistry-Paraffin: Collagen VI alpha 1 Antibody [NBP1-91193]

Immunohistochemistry-Paraffin: Collagen VI alpha 1 Antibody [NBP1-91193] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.

Applications for Collagen VI alpha 1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Collagen VI alpha 1

Collagens are highly conserved throughout evolution and are characterized by an uninterrupted "Glycine-X-Y" triplet repeat that is a necessary part of the triple helical structure. For these reasons it is often extremely difficult to generate antibodies with specificities to collagens. The development of type specific antibodies is dependent on NON-DENATURED three-dimensional epitopes. Collagens are extensively purified for immunization from human and bovine placenta and cartilage by limited pepsin digestion and selective salt precipitation. This preparation results in a native conformation of the protein. Antibodies are isolated from rabbit antiserum and are extensively cross-adsorbed by immunoaffinity purification to produce 'type' specific antibodies. Greatly diminished reactivity and selectivity of these antibodies will result if denaturing and reducing conditions of SDS-PAGE and immunoblotting are used.

Alternate Names

Collagen 6, collagen alpha-1(VI) chain, collagen VI, alpha-1 polypeptide, collagen, type VI, alpha 1, Collagen-6, human mRNA for collagen VI alpha-1 C-terminal globular domain10alpha 1 (VI) chain (61 AA), OPLL

Gene Symbol

COL6A1

Additional Collagen VI alpha 1 Products

Product Documents for Collagen VI alpha 1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Collagen VI alpha 1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Collagen VI alpha 1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Collagen VI alpha 1 Antibody - BSA Free and earn rewards!

Have you used Collagen VI alpha 1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...