CPSF6 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-85676
Loading...
Key Product Details
Validated by
Knockout/Knockdown
Species Reactivity
Validated:
Human, Mouse, Rat
Cited:
Human
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Knockdown Validated
Cited:
Western Blot, Immunocytochemistry/ Immunofluorescence, IF/IHC, Knockdown Validated
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ISPSANNGDAPEDRDYMDTLPPTVGDDVGKGAAPNVVYTYTGKRIALYIGNLTWWTTDEDLTEAVHSLGVN
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for CPSF6 Antibody - BSA Free
Western Blot: CPSF6 Antibody [NBP1-85676]
CPSF6-Antibody-Western-Blot-NBP1-85676-img0018.jpgImmunocytochemistry/ Immunofluorescence: CPSF6 Antibody [NBP1-85676]
CPSF6-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-85676-img0016.jpgImmunocytochemistry/ Immunofluorescence: CPSF6 Antibody [NBP1-85676]
Immunocytochemistry/Immunofluorescence: CPSF6 Antibody [NBP1-85676] - Staining of human cell line A-431 shows localization to nucleoplasm & nuclear speckles. Antibody staining is shown in green.Immunohistochemistry-Paraffin: CPSF6 Antibody [NBP1-85676]
Immunohistochemistry-Paraffin: CPSF6 Antibody [NBP1-85676] - Staining of human lymph node shows strong nuclear positivity in lymphoid cells.Western Blot: CPSF6 Antibody [NBP1-85676] -
Western Blot: CPSF6 Antibody [NBP1-85676] - CPSF6-358 inhibits HIV-1 replication when localized to the cytoplasm. (A) CPSF6 protein in TZM-bl cells transduced with empty, CPSF6-358, CPSF6-358 NLS & CPSF6-358 NES vectors. Cell lysates were probed in western blots with anti-CPSF6 antibody (upper panel) & anti-beta -actin antibody (lower panel). The upper panel shows the endogenous CPSF6 & the truncated form. (B) Indirect immunofluorescence showing localization of the different forms of CPSF6-358. The TZM-bl cells, transduced as in (A), were stained with an anti-HA antibody (green) for the detection of the CPSF6-358 proteins. DAPI was used to mark the nuclear compartment (blue). (C) TZM-bl stably expressing the different forms of CPSF6-358 were challenged with WT or CA mutant HIV-1NL4-3GFP reporter viruses. After 72 hrs, GFP reporter expression was assessed by flow cytometry. Data represent one of at least three independent experiments. Error bars represent ± SEM (n = 3). Image collected & cropped by CiteAb from the following publication (https://retrovirology.biomedcentral.com/articles/10.1186/1742-4690-10-20), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: CPSF6 Antibody [NBP1-85676] -
Western Blot: CPSF6 Antibody [NBP1-85676] - HIV-1 replication is inhibited when full-length CPSF6 is targeted to the cytoplasm. (A) Expression levels of CPSF6 in TZM-bl cells transduced with empty, CPSF6, CPSF6-NLS & CPSF6-NES vectors. Cell lysates were probed in western blots with anti-CPSF6 antibody (upper panel) & anti-beta -actin antibody (lower panel). The upper panel shows the endogenous & exogenous full-length CPSF6 with an HA tag. (B) Localization of different forms of CPSF6 in TZM-bl cells stably expressing CPSF6, CPSF6 NLS or CPSF6 NES. The cells were stained with an anti-HA antibody (green) for the detection of the CPSF6 proteins. DAPI staining (blue) was used to mark the nuclear compartment. (C) TZM-bl stably expressing the different forms of CPSF6 were challenged with WT or CA mutant HIV-1NL4-3GFP reporter viruses. After 72 hours, GFP reporter expression was assessed by flow cytometry. Data represent one of at least three independent experiments. Error bars represent ± SEM (n = 3). Image collected & cropped by CiteAb from the following publication (https://retrovirology.biomedcentral.com/articles/10.1186/1742-4690-10-20), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: CPSF6 Antibody [NBP1-85676] -
Western Blot: CPSF6 Antibody [NBP1-85676] - HIV-1 replication is inhibited when full-length CPSF6 is targeted to the cytoplasm. (A) Expression levels of CPSF6 in TZM-bl cells transduced with empty, CPSF6, CPSF6-NLS & CPSF6-NES vectors. Cell lysates were probed in western blots with anti-CPSF6 antibody (upper panel) & anti-beta -actin antibody (lower panel). The upper panel shows the endogenous & exogenous full-length CPSF6 with an HA tag. (B) Localization of different forms of CPSF6 in TZM-bl cells stably expressing CPSF6, CPSF6 NLS or CPSF6 NES. The cells were stained with an anti-HA antibody (green) for the detection of the CPSF6 proteins. DAPI staining (blue) was used to mark the nuclear compartment. (C) TZM-bl stably expressing the different forms of CPSF6 were challenged with WT or CA mutant HIV-1NL4-3GFP reporter viruses. After 72 hours, GFP reporter expression was assessed by flow cytometry. Data represent one of at least three independent experiments. Error bars represent ± SEM (n = 3). Image collected & cropped by CiteAb from the following publication (https://retrovirology.biomedcentral.com/articles/10.1186/1742-4690-10-20), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: CPSF6 Antibody [NBP1-85676] -
Western Blot: CPSF6 Antibody [NBP1-85676] - The effect of CPSF6-358 on the infectivity of HIV-1 CA mutants correlates with the effect of TNPO3 KD. (A) Schematic representation of the protein domains of WT CPSF6 & the truncated mutant CPSF6-358. RNA recognition motif (RRM), proline-rich domain (P-rich), arginine/serine rich domain (RS). (B) Expression levels of CPSF6 in TZM-bl cells transduced with empty or CPSF6-358 vectors. Cell lysates were probed in western blots with anti-CPSF6 antibody (upper panel) & anti-beta -actin antibody (lower panel). The upper panel shows the endogenous CPSF6 & the truncated form. (C) TZM-bl cells transduced with an empty vector or with a vector encoding CPSF6-358 were challenged with a panel of 27 HIV-1-GFP reporter vectors bearing either WT CA or the indicated CA mutants. At 72 hrs the percent GFP+ cells was determined by flow cytometry as an indication of infectivity. The ratio of HIV-1 infectivity in CPSF6-358 expressing cells & empty vector cells is shown. White bars show CA mutants inhibited to a similar extent as the WT virus by CPSF6-358, black bars shows CA mutants insensitive or slightly sensitive to CPSF6-358, & gray bars show CA mutants hypersensitive to the presence of CPSF6-358 in the cell. (D) Correlation between the infectivity ratios of the 27 CA mutants when infecting Ctrl KD vs TNPO3 KD [8] & Empty vector vs CPSF6-358 (R2 = 0.8528). Image collected & cropped by CiteAb from the following publication (https://retrovirology.biomedcentral.com/articles/10.1186/1742-4690-10-20), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: CPSF6 Antibody [NBP1-85676] -
Western Blot: CPSF6 Antibody [NBP1-85676] - TNPO3 depletion does not inhibit HIV-1 if CPSF6 is independently targeted to the nucleus. (A) CPSF6 & TNPO3 protein in TZM-bl cells stably transduced with CPSF6 KD vectors, control or TNPO3 KD vectors, & rescue of CPSF6 (ntCPSF6) with or without the SV40 T-Ag NLS. Cell lysate was probed in western blots with anti-TNPO3 antibody (upper panel), anti-CPSF6 antibody (middle panel) & anti-beta -actin antibody (lower panel). (B) Localization of the non-targetable CPSF6 (ntCPSF6) constructs (green) in control (Ctrl) KD or TNPO3 KD TZM-bl cells stably depleted of CPSF6. DAPI staining (blue) was used to mark the nuclear compartment. (C) The pools of stable cell lines in (B) were challenged with WT or CA mutant HIV-1NL4-3GFP reporter viruses. After 72 hrs, GFP expression was checked by flow cytometry. Data represent one of at least three independent experiments. Error bars represent ± SEM (n = 3). Image collected & cropped by CiteAb from the following publication (https://retrovirology.biomedcentral.com/articles/10.1186/1742-4690-10-20), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Immunocytochemistry/ Immunofluorescence: CPSF6 Antibody [NBP1-85676] -
Immunocytochemistry/ Immunofluorescence: CPSF6 Antibody [NBP1-85676] - TNPO3 depletion does not inhibit HIV-1 if CPSF6 is independently targeted to the nucleus. (A) CPSF6 & TNPO3 protein in TZM-bl cells stably transduced with CPSF6 KD vectors, control or TNPO3 KD vectors, & rescue of CPSF6 (ntCPSF6) with or without the SV40 T-Ag NLS. Cell lysate was probed in western blots with anti-TNPO3 antibody (upper panel), anti-CPSF6 antibody (middle panel) & anti-beta -actin antibody (lower panel). (B) Localization of the non-targetable CPSF6 (ntCPSF6) constructs (green) in control (Ctrl) KD or TNPO3 KD TZM-bl cells stably depleted of CPSF6. DAPI staining (blue) was used to mark the nuclear compartment. (C) The pools of stable cell lines in (B) were challenged with WT or CA mutant HIV-1NL4-3GFP reporter viruses. After 72 hrs, GFP expression was checked by flow cytometry. Data represent one of at least three independent experiments. Error bars represent ± SEM (n = 3). Image collected & cropped by CiteAb from the following publication (https://retrovirology.biomedcentral.com/articles/10.1186/1742-4690-10-20), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Immunohistochemistry-Paraffin: CPSF6 Antibody - BSA Free [NBP1-85676]
Staining of human colon shows strong nuclear positivity in glandular cells.Immunohistochemistry-Paraffin: CPSF6 Antibody - BSA Free [NBP1-85676]
Staining of human cerebral cortex shows strong nuclear positivity in neurons.Immunohistochemistry-Paraffin: CPSF6 Antibody - BSA Free [NBP1-85676]
Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.Western Blot: CPSF6 Antibody - BSA Free [NBP1-85676]
Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.Western Blot: CPSF6 Antibody - BSA Free [NBP1-85676]
Analysis in human cell line HL-60.Applications for CPSF6 Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Immunohistochemistry
1:500 - 1:1000
Immunohistochemistry-Paraffin
1:500 - 1:1000
Western Blot
0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: CPSF6
Alternate Names
CFIM, CFIm68, CFIM68CPSF 68 kDa subunit, CFIMcleavage and polyadenylation specific factor 6, 68kD subunit, cleavage and polyadenylation specific factor 6, 68kDa, Cleavage and polyadenylation specificity factor 68 kDa subunit, cleavage and polyadenylation specificity factor subunit 6, HPBRII-4, HPBRII-7, pre-mRNA cleavage factor I, 68kD subunit, pre-mRNA cleavage factor Im (68kD), Pre-mRNA cleavage factor Im 68 kDa subunit, Protein HPBRII-4/7
Gene Symbol
CPSF6
Additional CPSF6 Products
Product Documents for CPSF6 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for CPSF6 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for CPSF6 Antibody - BSA Free
Customer Reviews for CPSF6 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review CPSF6 Antibody - BSA Free and earn rewards!
Have you used CPSF6 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...