Creatine kinase MT 1B Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP3-05655

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human, Mouse, Rat

Cited:

Mouse

Applications

Validated:

Western Blot, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation

Cited:

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
View all Creatine kinase MT 1B Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-85 of human Creatine kinase MT 1B (NP_066270.1). MAGPFSRLLSARPGLRLLALAGAGSLAAGFLLRPEPVRAASERRRLYPPSAEYPDLRKHNNCMASHLTPAVYARLCDKTTPTGWT

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Creatine kinase MT 1B Antibody - Azide and BSA Free

Western Blot: Creatine kinase MT 1B AntibodyAzide and BSA Free [NBP3-05655]

Western Blot: Creatine kinase MT 1B AntibodyAzide and BSA Free [NBP3-05655]

Western Blot: Creatine kinase MT 1B Antibody [NBP3-05655] - Analysis of extracts of various cell lines, using Creatine kinase MT 1B antibody (NBP3-05655) at 1:3000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3s.
Immunoprecipitation: Creatine kinase MT 1B Antibody - Azide and BSA Free [NBP3-05655]

Immunoprecipitation: Creatine kinase MT 1B Antibody - Azide and BSA Free [NBP3-05655]

Immunoprecipitation: Creatine kinase MT 1B Antibody [NBP3-05655] - Analysis of 600ug extracts of Mouse brain cells using 3ug CKMT1B antibody. Western blot was performed from the immunoprecipitate using CKMT1B antibody at a dilition of 1:1000.
Immunocytochemistry/ Immunofluorescence: Creatine kinase MT 1B Antibody - Azide and BSA Free [NBP3-05655]

Immunocytochemistry/ Immunofluorescence: Creatine kinase MT 1B Antibody - Azide and BSA Free [NBP3-05655]

Immunocytochemistry/Immunofluorescence: Creatine kinase MT 1B Antibody [NBP3-05655] - Immunofluorescence analysis of U-2 OS cells using Creatine kinase MT 1B Polyclonal Antibody (NBP3-05655) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Creatine kinase MT 1B Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: Creatine kinase MT 1B Antibody - Azide and BSA Free [NBP3-05655] -

Immunocytochemistry/ Immunofluorescence: Creatine kinase MT 1B Antibody - Azide and BSA Free [NBP3-05655] - Immunofluorescence analysis of NIH-3T3 cells using Creatine kinase MT 1B Rabbit pAb (A3046) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for Creatine kinase MT 1B Antibody - Azide and BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:100

Immunoprecipitation

1:500 - 1:1000

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Creatine kinase MT 1B

Mitochondrial creatine (MtCK) kinase is responsible for the transfer of high energy phosphate from mitochondria to the cytosolic carrier, creatine. It belongs to the creatine kinase isoenzyme family. It exists as two isoenzymes, sarcomeric MtCK and ubiquitous MtCK, encoded by separate genes. Mitochondrial creatine kinase occurs in two different oligomeric forms: dimers and octamers, in contrast to the exclusively dimeric cytosolic creatine kinase isoenzymes. Many malignant cancers with poor prognosis have shown overexpression of ubiquitous mitochondrial creatine kinase; this may be related to high energy turnover and failure to eliminate cancer cells via apoptosis. Ubiquitous mitochondrial creatine kinase has 80% homology with the coding exons of sarcomeric mitochondrial creatine kinase. Two genes located near each other on chromosome 15 have been identified which encode identical mitochondrial creatine kinase proteins. [provided by RefSeq]

Alternate Names

Acidic-Type Mitochondrial Creatine Kinase, CKMT, CKMT1, CKMT1B, Creatine Kinase U-Type, Mitochondrial, Creatine Kinase, Mitochondrial 1 (Ubiquitous), Creatine Kinase, Mitochondrial 1B, EC 2.7.3.2, Mia-CK, Ubiquitous Mitochondrial Creatine Kinase, UMTCK, U-MtCK

Gene Symbol

CKMT1B

Additional Creatine kinase MT 1B Products

Product Documents for Creatine kinase MT 1B Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Creatine kinase MT 1B Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Citations for Creatine kinase MT 1B Antibody - Azide and BSA Free

Customer Reviews for Creatine kinase MT 1B Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review Creatine kinase MT 1B Antibody - Azide and BSA Free and earn rewards!

Have you used Creatine kinase MT 1B Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies