Creatine kinase MT 1B Antibody - Azide and BSA Free
Novus Biologicals | Catalog # NBP3-05655
Loading...
Key Product Details
Species Reactivity
Validated:
Human, Mouse, Rat
Cited:
Mouse
Applications
Validated:
Western Blot, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation
Cited:
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
Azide and BSA Free
Loading...
Product Specifications
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-85 of human Creatine kinase MT 1B (NP_066270.1). MAGPFSRLLSARPGLRLLALAGAGSLAAGFLLRPEPVRAASERRRLYPPSAEYPDLRKHNNCMASHLTPAVYARLCDKTTPTGWT
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for Creatine kinase MT 1B Antibody - Azide and BSA Free
Western Blot: Creatine kinase MT 1B AntibodyAzide and BSA Free [NBP3-05655]
Western Blot: Creatine kinase MT 1B Antibody [NBP3-05655] - Analysis of extracts of various cell lines, using Creatine kinase MT 1B antibody (NBP3-05655) at 1:3000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3s.Immunoprecipitation: Creatine kinase MT 1B Antibody - Azide and BSA Free [NBP3-05655]
Immunoprecipitation: Creatine kinase MT 1B Antibody [NBP3-05655] - Analysis of 600ug extracts of Mouse brain cells using 3ug CKMT1B antibody. Western blot was performed from the immunoprecipitate using CKMT1B antibody at a dilition of 1:1000.Immunocytochemistry/ Immunofluorescence: Creatine kinase MT 1B Antibody - Azide and BSA Free [NBP3-05655]
Immunocytochemistry/Immunofluorescence: Creatine kinase MT 1B Antibody [NBP3-05655] - Immunofluorescence analysis of U-2 OS cells using Creatine kinase MT 1B Polyclonal Antibody (NBP3-05655) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.Immunocytochemistry/ Immunofluorescence: Creatine kinase MT 1B Antibody - Azide and BSA Free [NBP3-05655] -
Immunocytochemistry/ Immunofluorescence: Creatine kinase MT 1B Antibody - Azide and BSA Free [NBP3-05655] - Immunofluorescence analysis of NIH-3T3 cells using Creatine kinase MT 1B Rabbit pAb (A3046) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.Applications for Creatine kinase MT 1B Antibody - Azide and BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
1:50 - 1:100
Immunoprecipitation
1:500 - 1:1000
Western Blot
1:500 - 1:2000
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol
Format
Azide and BSA Free
Preservative
0.01% Thimerosal
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: Creatine kinase MT 1B
Alternate Names
Acidic-Type Mitochondrial Creatine Kinase, CKMT, CKMT1, CKMT1B, Creatine Kinase U-Type, Mitochondrial, Creatine Kinase, Mitochondrial 1 (Ubiquitous), Creatine Kinase, Mitochondrial 1B, EC 2.7.3.2, Mia-CK, Ubiquitous Mitochondrial Creatine Kinase, UMTCK, U-MtCK
Gene Symbol
CKMT1B
Additional Creatine kinase MT 1B Products
Product Documents for Creatine kinase MT 1B Antibody - Azide and BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Creatine kinase MT 1B Antibody - Azide and BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.govCitations for Creatine kinase MT 1B Antibody - Azide and BSA Free
Customer Reviews for Creatine kinase MT 1B Antibody - Azide and BSA Free
There are currently no reviews for this product. Be the first to review Creatine kinase MT 1B Antibody - Azide and BSA Free and earn rewards!
Have you used Creatine kinase MT 1B Antibody - Azide and BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunoprecipitation Protocol
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...