CRHBP Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-91811

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all CRHBP Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: TLTIKTDPNLFPCNVISQTPNGKFTLVVPHQHRNCSFSIIYPVVIKISDLTLGHVNGLQLKKSSAGCEGIGDFVE

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (84%), Rat (81%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for CRHBP Antibody - BSA Free

Immunohistochemistry-Paraffin: CRHBP Antibody [NBP1-91811]

Immunohistochemistry-Paraffin: CRHBP Antibody [NBP1-91811]

Immunohistochemistry-Paraffin: CRHBP Antibody [NBP1-91811] - Staining of human testis shows strong positivity in secretion.
Immunohistochemistry-Paraffin: CRHBP Antibody [NBP1-91811]

Immunohistochemistry-Paraffin: CRHBP Antibody [NBP1-91811]

Immunohistochemistry-Paraffin: CRHBP Antibody [NBP1-91811] - Staining of human placenta shows distinct extracellular positivity.
Immunohistochemistry-Paraffin: CRHBP Antibody [NBP1-91811]

Immunohistochemistry-Paraffin: CRHBP Antibody [NBP1-91811]

Immunohistochemistry-Paraffin: CRHBP Antibody [NBP1-91811] - Staining of human kidney shows moderate to strong positivity in secretion.
Immunohistochemistry: CRHBP Antibody [NBP1-91811]

Immunohistochemistry: CRHBP Antibody [NBP1-91811]

Immunohistochemistry: CRHBP Antibody [NBP1-91811] - Staining of human small intestine shows strong positivity in secretion.
CRHBP Antibody - BSA Free Western Blot: CRHBP Antibody - BSA Free [NBP1-91811]

Western Blot: CRHBP Antibody - BSA Free [NBP1-91811]

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp

Applications for CRHBP Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200-1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CRHBP

Corticotropin-releasing hormone is a potent stimulator of synthesis and secretion of preopiomelanocortin-derived peptides. Although CRH concentrations in the human peripheral circulation are normally low, they increase throughout pregnancy and fall rapidly after parturition. Maternal plasma CRH probably originates from the placenta. Human plasma contains a CRH-binding protein which inactivates CRH and which may prevent inappropriate pituitary-adrenal stimulation in pregnancy. [provided by RefSeq]

Long Name

Corticotropin Releasing Hormone Binding Protein

Alternate Names

CRFBP

Gene Symbol

CRHBP

Additional CRHBP Products

Product Documents for CRHBP Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for CRHBP Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CRHBP Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CRHBP Antibody - BSA Free and earn rewards!

Have you used CRHBP Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies