CRMP4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87213

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunoprecipitation

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CRMP4. Peptide sequence: VFDLTTTPKGGTPAGSARGSPTRPNPPVRNLHQSGFSLSGTQVDEGVRSA The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for CRMP4 Antibody - BSA Free

Western Blot: CRMP4 Antibody [NBP2-87213]

Western Blot: CRMP4 Antibody [NBP2-87213]

Western Blot: CRMP4 Antibody [NBP2-87213] - WB Suggested Anti-DPYSL3 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:1562500. Positive Control: Transfected 293T
Immunohistochemistry: CRMP4 Antibody [NBP2-87213]

Immunohistochemistry: CRMP4 Antibody [NBP2-87213]

Immunohistochemistry: CRMP4 Antibody [NBP2-87213] - Immunohistochemistry with Small intestine, submucosal plexus tissue. Antibody concentration: 10ug/ml
Immunoprecipitation: CRMP4 Antibody [NBP2-87213]

Immunoprecipitation: CRMP4 Antibody [NBP2-87213]

Immunoprecipitation: CRMP4 Antibody [NBP2-87213] - DRYSL3 was immunoprecipitated from 1 mg HEK293 Whole Cell Lysate with NBP2-87213 with 1:200 dilution. Western blot was performed using NBP2-87213 at 1/1000 dilution. Lane 1: Control IP in HEK293 Whole Cell Lysate. Lane 2: DRYSL3 IP with NBP2-87213

Applications for CRMP4 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CRMP4

The collapsin response mediator protein (CRMP) family of five cytosolic phosphoproteins are highly expressed throughout brain development. The functions of CRMPs encompass signal transduction in developmental guidance cues as well as multiple cellular and molecular events involved in apoptosis/proliferation, cell migration, and differentiation. In the adult brain, the expression of CRMPs is dramatically downregulated. However, CRMPs remain expressed in structures that retain their capacity for differentiation and plasticity. The expression of CRMPs is altered in neurodegenerative diseases, and these proteins may have a role in the physiopathology of the adult nervous system.

Alternate Names

Collapsin response mediator protein 4, CRMP-4, CRMP4collapsin response mediator protein 4 long, dihydropyrimidinase-like 3, DRP-3dihydropyrimidinase-related protein 3, DRP3ULIP1, ULIP-1, ULIPLCRMP, Unc-33-like phosphoprotein 1

Gene Symbol

DPYSL3

Additional CRMP4 Products

Product Documents for CRMP4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CRMP4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CRMP4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CRMP4 Antibody - BSA Free and earn rewards!

Have you used CRMP4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...