CSE1L/CAS/Exportin-2 Antibody (3D8) - Azide and BSA Free

Novus Biologicals | Catalog # H00001434-M08

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG1 kappa Clone # 3D8

Format

Azide and BSA Free
View all CSE1L/CAS Primary Antibodies »

Product Specifications

Immunogen

CSE1L (NP_001307, 872 a.a. ~ 971 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LIGLFELPEDDTIPDEEHFIDIEDTPGYQTAFSQLAFAGKKEHDPVGQMVNNPKIHLAQSLHKLSTACPGRVPSMVSTSLNAEALQYLQGYLQAARVTLL

Specificity

CSE1L - CSE1 chromosome segregation 1-like (yeast)

Clonality

Monoclonal

Host

Mouse

Isotype

IgG1 kappa

Description

Quality control test: Antibody Reactive Against Recombinant Protein.

Scientific Data Images for CSE1L/CAS/Exportin-2 Antibody (3D8) - Azide and BSA Free

Western Blot: CSE1L/CAS/Exportin-2 Antibody (3D8) [H00001434-M08]

Western Blot: CSE1L/CAS/Exportin-2 Antibody (3D8) [H00001434-M08]

Western Blot: CSE1L/CAS/Exportin-2 Antibody (3D8) [H00001434-M08] - Analysis of CSE1L expression in Hela S3 NE (Cat # L013V3).
Immunocytochemistry/ Immunofluorescence: CSE1L/CAS/Exportin-2 Antibody (3D8) [H00001434-M08]

Immunocytochemistry/ Immunofluorescence: CSE1L/CAS/Exportin-2 Antibody (3D8) [H00001434-M08]

Immunocytochemistry/Immunofluorescence: CSE1L/CAS/Exportin-2 Antibody (3D8) [H00001434-M08] - Analysis of monoclonal antibody to CSE1L on HeLa cell. Antibody concentration 10 ug/mL.
Immunohistochemistry-Paraffin: CSE1L/CAS/Exportin-2 Antibody (3D8) [H00001434-M08]

Immunohistochemistry-Paraffin: CSE1L/CAS/Exportin-2 Antibody (3D8) [H00001434-M08]

Immunohistochemistry-Paraffin: CSE1L/CAS/Exportin-2 Antibody (3D8) [H00001434-M08] - Mouse prostate tissue section stained with primary antibody for 10 hrs. IHC-P image submitted by a verified customer review.
Immunohistochemistry-Paraffin: CSE1L/CAS/Exportin-2 Antibody (3D8) [H00001434-M08]

Immunohistochemistry-Paraffin: CSE1L/CAS/Exportin-2 Antibody (3D8) [H00001434-M08]

Immunohistochemistry-Paraffin: CSE1L/CAS/Exportin-2 Antibody (3D8) [H00001434-M08] - Analysis of monoclonal antibody to CSE1L on FFPE human prostate. Antibody concentration 3 ug/mL.
ELISA: CSE1L/CAS/Exportin-2 Antibody (3D8) [H00001434-M08]

ELISA: CSE1L/CAS/Exportin-2 Antibody (3D8) [H00001434-M08]

ELISA: CSE1L/CAS/Exportin-2 Antibody (3D8) [H00001434-M08] - Detection limit for recombinant GST tagged CSE1L is approximately 3ng/ml as a capture antibody.
CSE1L/CAS/Exportin-2 Antibody (3D8)

Western Blot: CSE1L/CAS/Exportin-2 Antibody (3D8) [H00001434-M08] -

Western Blot: CSE1L/CAS/Exportin-2 Antibody (3D8) [H00001434-M08] - Vemurafenib treatment inhibits the phosphorylation of CSE1L & ERK1/2. a Vemurafenib treatment inhibited the phosphorylation of ERK1/2 & CSE1L. The levels of hyper-phosphorylated CSE1L, hypo-phosphorylated CSE1L, & phospho-ERK1/2 in A375 melanoma cells treated with or without 1 μM vemurafenib for 24 h were subjected to immunoblotting with anti-CSE1L (clone 3D8), anti-phospho-CSE1L, & anti-phospho-ERK1/2 antibodies. beta -actin levels were assayed as a control. b A representative image shows vemurafenib-induced apoptotic body formation in A375 melanoma cells. Cells were treated with or without 1 μM vemurafenib for 72 h. c DNA fragmentation induced by vemurafenib in A375 melanoma cells treated with or without 1 μM vemurafenib for 72 h. Each immunoblot was repeated at least three times & showed similar results. The data shown here are the representative immunoblots. Image collected & cropped by CiteAb from the following publication (http://www.translational-medicine.com/content/13/1/191), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
CSE1L/CAS/Exportin-2 Antibody (3D8)

Western Blot: CSE1L/CAS/Exportin-2 Antibody (3D8) [H00001434-M08] -

Western Blot: CSE1L/CAS/Exportin-2 Antibody (3D8) [H00001434-M08] - Presence of hyper-, hypo-, & non-phosphorylated CSE1L in tumor cells as analyzed by antibodies against CSE1L & phosphorylated CSE1L. a The levels of phosphorylated & non-phosphorylated CSE1L in B16-dEV, B16-Ras, & PD98059-treated B16-Ras cells were analyzed with anti-CSE1L antibody (clone 3D8) as indicated. b The levels of phospho-CSE1L & phospho-ERK1/2 in B16-dEV, B16-CSE1L, & B16-Ras cells were analyzed with anti-phospho-CSE1L & anti-phospho-ERK1/2 antibodies as indicated. c Presence of hyper- & hypo-phosphorylated CSE1L in B16-Ras cells analyzed using lambda protein phosphatase. B16-Ras cell lysates treated with or without lambda protein phosphatase were subjected to immunoblotting with anti-CSE1L (3D8), anti-phospho-CSE1L, & anti-phospho-ERK1/2 antibodies as indicated. d Presence of non-phosphorylated & phosphorylated CSE1L as analyzed using serum-starved & serum re-fed non-cancerous cell lines. The phosphorylation of CSE1L in cell lysates from serum starved or serum starved & serum retreated HT-29 colorectal cancer cells, human foreskin fibroblast cells, NIH3T3 cells, & B16F10 melanoma cells were analyzed using the anti-CSE1L (clone 24) antibody. e Distribution of secretory phospho-CSE1L in the extracellular secretion vesicles (arrowhead) surrounding B16-Ras cells was analyzed by immunofluorescence with anti-phospho-CSE1L antibodies. Each immunoblot was repeated at least three times & showed similar results. The data shown here are the representative immunoblots. beta -actin levels were assayed as a control. pp-CSE1L hyper-phosphorylated CSE1L, p-CSE1L hypo-phosphorylated CSE1L, non-p-CSE1L non-phosphorylated CSE1L. Image collected & cropped by CiteAb from the following publication (http://www.translational-medicine.com/content/13/1/191), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
CSE1L/CAS/Exportin-2 Antibody (3D8)

Western Blot: CSE1L/CAS/Exportin-2 Antibody (3D8) [H00001434-M08] -

Western Blot: CSE1L/CAS/Exportin-2 Antibody (3D8) [H00001434-M08] - Sorafenib treatment inhibits the phosphorylation of CSE1L & ERK1/2. a Sorafenib treatment inhibited the phosphorylation of ERK1/2 & CSE1L. The levels of hyper-phosphorylated CSE1L, hypo-phosphorylated CSE1L, & phospho-ERK1/2 in HT-29 colorectal cancer cells treated with or without 6 μM sorafenib for 24 h were subjected to immunoblotting with anti-CSE1L (clone 3D8), anti-phospho-CSE1L, & anti-phospho-ERK1/2 antibodies. beta -actin levels were assayed as a control. Each immunoblot was repeated at least three times & showed similar results. The data shown here are the representative immunoblots. b The cell numbers of HT-29 colorectal cancer cells treated with or without 6 μM sorafenib for 96 h were counted using trypan blue exclusion assays. The graph summarizes the results of three independent assays. Image collected & cropped by CiteAb from the following publication (http://www.translational-medicine.com/content/13/1/191), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for CSE1L/CAS/Exportin-2 Antibody (3D8) - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB.

Reviewed Applications

Read 1 review rated 5 using H00001434-M08 in the following applications:

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: CSE1L/CAS

Proteins that carry a nuclear localization signal (NLS) are transported into the nucleus by the importin-alpha/beta heterodimer. Importin-alpha binds the NLS, while importin-beta mediates translocation through the nuclear pore complex. After translocation, RanGTP binds importin-beta and displaces importin-alpha. Importin-alpha must then be returned to the cytoplasm, leaving the NLS protein behind. The protein encoded by this gene binds strongly to NLS-free importin-alpha, and this binding is released in the cytoplasm by the combined action of RANBP1 and RANGAP1. In addition, the encoded protein may play a role both in apoptosis and in cell proliferation.

Long Name

Chromosome segregation 1-like protein

Alternate Names

CAS, CSE1, XPO2

Entrez Gene IDs

1434 (Human)

Gene Symbol

CSE1L

OMIM

601342 (Human)

UniProt

NP_001307 (Human)

Additional CSE1L/CAS Products

Product Documents for CSE1L/CAS/Exportin-2 Antibody (3D8) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for CSE1L/CAS/Exportin-2 Antibody (3D8) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for CSE1L/CAS/Exportin-2 Antibody (3D8) - Azide and BSA Free

Customer Reviews for CSE1L/CAS/Exportin-2 Antibody (3D8) - Azide and BSA Free (1)

5 out of 5
1 Customer Rating
5 Stars
100%
4 Stars
0%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used CSE1L/CAS/Exportin-2 Antibody (3D8) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images

Showing  1 - 1 of 1 review Showing All
Filter By:
Clear Filters X
  • CSE1L/CAS/Exportin-2 Antibody (3D8)
    Name: Anonymous
    Application: Immunohistochemistry-Paraffin
    Sample Tested: Prostate tissue
    Species: Mouse
    Verified Customer | Posted 12/09/2021
    Prostate tissue
    Incubated samples with the primary antibody for 10 hours
    CSE1L/CAS/Exportin-2 Antibody (3D8) - Azide and BSA Free H00001434-M08

There are no reviews that match your criteria.

Showing  1 - 1 of 1 review Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies