CXXC1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-84739

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CXXC1. Peptide sequence: ERIRREQQSARTRLQEMERRFHELEAIILRAKQQAVREDEESNEGDSDDT The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for CXXC1 Antibody - BSA Free

Western Blot: CXXC1 Antibody [NBP2-84739]

Western Blot: CXXC1 Antibody [NBP2-84739]

Western Blot: CXXC1 Antibody [NBP2-84739] - WB Suggested Anti-CXXC1 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:62500. Positive Control: THP-1 cell lysate
Immunohistochemistry-Paraffin: CXXC1 Antibody [NBP2-84739]

Immunohistochemistry-Paraffin: CXXC1 Antibody [NBP2-84739]

Immunohistochemistry-Paraffin: CXXC1 Antibody [NBP2-84739] - Rabbit Anti-CXXC1 antibody. Formalin Fixed Paraffin Embedded Tissue: Human Skin. Primary antibody Concentration: 1:100. Secondary Antibody: Donkey anti-Rabbit-Cy3. Secondary Antibody Concentration: 1:200. Magnification: 20x. Exposure Time: 0.5-2.0sec
Immunohistochemistry-Paraffin: CXXC1 Antibody [NBP2-84739]

Immunohistochemistry-Paraffin: CXXC1 Antibody [NBP2-84739]

Immunohistochemistry-Paraffin: CXXC1 Antibody [NBP2-84739] - Rabbit Anti-CXXC1 antibody. Formalin Fixed Paraffin Embedded Tissue: Human Colon. Primary antibody Concentration: 1:100. Secondary Antibody: Donkey anti-Rabbit-Cy3. Secondary Antibody Concentration: 1:200. Magnification: 20x. Exposure Time: 0.5-2.0sec

Applications for CXXC1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CXXC1

Proteins that contain a CXXC motif within their DNA-binding domain, such as CXXC1, recognize CpG sequences and regulate gene expression (Carlone and Skalnik, 2001 (PubMed 11604496)).(supplied by OMIM)

Alternate Names

CFP1CXXC-type zinc finger protein 1, CGBPPHD finger and CXXC domain-containing protein 1, CpG binding protein, cpG-binding protein, CXXC finger 1 (PHD domain), CXXC finger protein 1, DNA-binding protein with PHD finger and CXXC domain, hCGBP, HsT2645, PCCX12410002I16Rik, PHF185830420C16Rik, SPP1, ZCGPC1, zinc finger, CpG binding-type containing 1

Gene Symbol

CXXC1

Additional CXXC1 Products

Product Documents for CXXC1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CXXC1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CXXC1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CXXC1 Antibody - BSA Free and earn rewards!

Have you used CXXC1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...