CXXC5 Antibody - BSA Free
Novus Biologicals | Catalog # NBP2-58775
![Western Blot: CXXC5 Antibody [NBP2-58775]](https://resources.rndsystems.com/images/products/CXXC5-Antibody-Western-Blot-NBP2-58775-img0002.jpg "Western Blot: CXXC5 Antibody [NBP2-58775]")
Loading...
Key Product Details
Species Reactivity
Validated:
Human
Predicted:
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Applications
Western Blot, Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ASLLANGHDLAAAMAVDKSNPTSKHKSGAVASLLSKAERATELAAEGQLTLQQFAQSTEMLKRVVQEHLPL
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for CXXC5 Antibody - BSA Free
Western Blot: CXXC5 Antibody [NBP2-58775]
Western Blot: CXXC5 Antibody [NBP2-58775] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.![Immunocytochemistry/ Immunofluorescence: CXXC5 Antibody [NBP2-58775]](https://resources.rndsystems.com/images/products/CXXC5-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-58775-img0001.jpg "Immunocytochemistry/ Immunofluorescence: CXXC5 Antibody [NBP2-58775]")
Immunocytochemistry/ Immunofluorescence: CXXC5 Antibody [NBP2-58775]
Immunocytochemistry/Immunofluorescence: CXXC5 Antibody [NBP2-58775] - Staining of human cell line A-431 shows localization to nucleoplasm & cytosol.
Chromatin Immunoprecipitation ChIP: CXXC5 Antibody - BSA Free
ChIP-Exo-Seq composite graph for Anti-CXXC5 tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh's Lab at Cornell University.Applications for CXXC5 Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Western Blot
0.04-0.4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: CXXC5
Alternate Names
CF5, CXXC finger 5, CXXC finger 5 protein, CXXC finger protein 5, CXXC-type zinc finger protein 5, HSPC195, Putative MAPK-activating protein PM08, Putative NF-kappa-B-activating protein 102, retinoid-inducible nuclear factor, RINF, WID, WT1-induced Inhibitor of Dishevelled
Gene Symbol
CXXC5
Additional CXXC5 Products
Product Documents for CXXC5 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for CXXC5 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for CXXC5 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review CXXC5 Antibody - BSA Free and earn rewards!
Have you used CXXC5 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...