CYBB/NOX2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-59062

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

The peptide sequence was selected from the C terminal of CYBB/NOX2 (NP_000388). Peptide sequence YGRPNWDNEFKTIASQHPNTRIGVFLCGPEALAETLSKQSISNSESGPRG The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

65 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for CYBB/NOX2 Antibody - BSA Free

Western Blot: CYBB/NOX2 Antibody [NBP1-59062]

Western Blot: CYBB/NOX2 Antibody [NBP1-59062]

Western Blot: CYBB/NOX2 Antibody [NBP1-59062] - THP-1 cell lysate, Antibody Titration: 1.0ug/ml
Immunohistochemistry-Paraffin: CYBB/NOX2 Antibody [NBP1-59062]

Immunohistochemistry-Paraffin: CYBB/NOX2 Antibody [NBP1-59062]

Immunohistochemistry-Paraffin: CYBB/NOX2 Antibody [NBP1-59062] - Human Lung Alveolar cells (indicated with arrows), 4-8ug/ml.
Western Blot: CYBB/NOX2 Antibody [NBP1-59062]

Western Blot: CYBB/NOX2 Antibody [NBP1-59062]

Western Blot: CYBB/NOX2 Antibody [NBP1-59062] - MCF7 tissue lysate at a concentration of 1ug/ml.
Immunohistochemistry-Paraffin: CYBB/NOX2 Antibody [NBP1-59062]

Immunohistochemistry-Paraffin: CYBB/NOX2 Antibody [NBP1-59062]

Immunohistochemistry-Paraffin: CYBB/NOX2 Antibody [NBP1-59062] - Human Spleen

Applications for CYBB/NOX2 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Paraffin

1:10-1:500

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CYBB/NOX2

CYBB is a critical component of the membrane-bound oxidase of phagocytes that generates superoxide. It is the terminal component of a respiratory chain that transfers single electrons from cytoplasmic NADPH across the plasma membrane to molecular oxygen on the exterior. It also functions as a voltage-gated proton channel that mediates the H(+) currents of resting phagocytes. It participates in the regulation of cellular pH and is blocked by zinc. Defects in CYBB are a cause of X-linked chronic granulomatous disease (X-CGD).Cytochrome b (-245) is composed of cytochrome b alpha (CYBA) and beta (CYBB) chain. It has been proposed as a primary component of the microbicidal oxidase system of phagocytes. CYBB deficiency is one of five described biochemical defects associated with chronic granulomatous disease (CGD). In this disorder, there is decreased activity of phagocyte NADPH oxidase; neutrophils are able to phagocytize bacteria but cannot kill them in the phagocytic vacuoles. The cause of the killing defect is an inability to increase the cell's respiration and consequent failure to deliver activated oxygen into the phagocytic vacuole. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Long Name

Cytochrome b-245 heavy chain

Alternate Names

CGD91-phox, CYBB, EC 1.-.-.-, gp91-1, gp91-phox, NADPH oxidase 2, NOX2

Entrez Gene IDs

1536 (Human)

Gene Symbol

CYBB

UniProt

Additional CYBB/NOX2 Products

Product Documents for CYBB/NOX2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CYBB/NOX2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CYBB/NOX2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CYBB/NOX2 Antibody - BSA Free and earn rewards!

Have you used CYBB/NOX2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...