Cyclin A1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-56070

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Cyclin A1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GWGEEYLSWEGPGLPDFVFQQPVESEAMHCSNPKSGVVLATVARGPDACQILTRAPLGQDPPQRTVLGLLTANGQYRRTCGQGITRIRCYSGSENAFPPAGKKALPDC

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Cyclin A1 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: Cyclin A1 Antibody [NBP2-56070]

Immunocytochemistry/ Immunofluorescence: Cyclin A1 Antibody [NBP2-56070]

Immunocytochemistry/Immunofluorescence: Cyclin A1 Antibody [NBP2-56070] - Staining of human cell line U-2 OS shows localization to nucleoplasm & nuclear bodies. Antibody staining is shown in green.
Cyclin A1 Antibody - BSA Free Chromatin Immunoprecipitation ChIP: Cyclin A1 Antibody - BSA Free

Chromatin Immunoprecipitation ChIP: Cyclin A1 Antibody - BSA Free

ChIP-Exo-Seq composite graph for Anti-Cyclin A1 tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh's Lab at Cornell University.

Applications for Cyclin A1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Cyclin A1

The critical role that the family of regulatory proteins known as cyclins play in eukaryotic cell cycle regulation is well established. The best-characterized cyclin complex is the mitotic cyclin B/Cdc2 p34 kinase, the active component of maturing promoting factor. Cyclin A accumulates prior to cyclin B in the cell cycle, appears to be involved in control of S phase and has been shown to associate with cyclin-dependent kinase-2 (Cdk2). In addition, cyclin A has been implicated in cell transformation and is found in complexes with E1A, transcription factors DRTF1 and E2F and retinoblastoma protein, p110. A second form of cyclin A, named cyclin A1 because of its high sequence homology to Xenopus cyclin A1, is most highly expressed in germ cells. It has been proposed that cyclin A1 can associate with Cdk2, p39 and Cdc2 p34.

Alternate Names

CCNA1

Gene Symbol

CCNA1

Additional Cyclin A1 Products

Product Documents for Cyclin A1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Cyclin A1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Cyclin A1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Cyclin A1 Antibody - BSA Free and earn rewards!

Have you used Cyclin A1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies