Cyclin D2 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # H00000894-D01P

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence, Proximity Ligation Assay

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
View all Cyclin D2 Primary Antibodies »

Product Specifications

Immunogen

CCND2 (NP_001750.1, 1 a.a. - 289 a.a.) full-length human protein. MELLCHEVDPVRRAVRDRNLLRDDRVLQNLLTIEERYLPQCSYFKCVQKDIQPYMRRMVATWMLEVCEEQKCEEEVFPLAMNYLDRFLAGVPTPKSHLQLLGAVCMFLASKLKETSPLTAEKLCIYTDNSIKPQELLEWELVVLGKLKWNLAAVTPHDFIEHILRKLPQQREKLSLIRKHAQTFIALCATDFKFAMYPPSMIATGSVGAAICGLQQDEEVSSLTCDALTELLAKITNTDVDCLKACQEQIEAVLLNSLQQYRQDQRDGSKSEDELDQASTPTDVRDIDL

Specificity

CCND2 - cyclin D2,

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

Quality control test: Antibody reactive against mammalian transfected lysate.

Scientific Data Images for Cyclin D2 Antibody - Azide and BSA Free

Western Blot: Cyclin D2 Antibody [H00000894-D01P]

Western Blot: Cyclin D2 Antibody [H00000894-D01P]

Western Blot: Cyclin D2 Antibody [H00000894-D01P] - Analysis of CCND2 expression in transfected 293T cell line by CCND2 polyclonal antibody.Lane 1: CCND2 transfected lysate(33.10 KDa).Lane 2: Non-transfected lysate.
Immunocytochemistry/ Immunofluorescence: Cyclin D2 Antibody [H00000894-D01P]

Immunocytochemistry/ Immunofluorescence: Cyclin D2 Antibody [H00000894-D01P]

Immunocytochemistry/Immunofluorescence: Cyclin D2 Antibody [H00000894-D01P] - Analysis of antibody to CCND2 on HeLa cell. Antibody concentration 30 ug/ml.
Proximity Ligation Assay: Cyclin D2 Antibody [H00000894-D01P]

Proximity Ligation Assay: Cyclin D2 Antibody [H00000894-D01P]

Proximity Ligation Assay: Cyclin D2 Antibody [H00000894-D01P] - Analysis of protein-protein interactions between CCND2 and CDKN1A. HeLa cells were stained with anti-CCND2 rabbit purified polyclonal 1:1200 and anti-CDKN1A mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

Applications for Cyclin D2 Antibody - Azide and BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

Optimal dilutions of this antibody should be experimentally determined.

Proximity Ligation Assay

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
Antibody reactivity against transfected lysate for WB and recombinant protein with GST tag for ELISA and WB. GST tag alone is used as a negative control.

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS (pH 7.4)

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: Cyclin D2

The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of each mitotic event. This cyclin forms a complex with and functions as a regulatory subunit of CDK4 or CDK6, whose activity is required for cell cycle G1/S transition. This protein has been shown to interact with and be involved in the phosphorylation of tumor suppressor protein Rb. Knockout studies of the homologous gene in mouse suggest the essential roles of this gene in ovarian granulosa and germ cell proliferation. High level expression of this gene was observed in ovarian and testicular tumors. [provided by RefSeq]

Alternate Names

CCND2, Vin1

Entrez Gene IDs

894 (Human)

Gene Symbol

CCND2

UniProt

NP_001750.1 (Human)

Additional Cyclin D2 Products

Product Documents for Cyclin D2 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Cyclin D2 Antibody - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Cancer Biomarkers
Cell Cycle

Customer Reviews for Cyclin D2 Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review Cyclin D2 Antibody - Azide and BSA Free and earn rewards!

Have you used Cyclin D2 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies