Cyclin L2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-47497

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (96%), Rat (96%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: DRLYSGVLITLENCLLPDDKLRFTPSMSSGLDTDTETDLRVVGCEL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Cyclin L2 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: Cyclin L2 Antibody [NBP2-47497]

Immunocytochemistry/ Immunofluorescence: Cyclin L2 Antibody [NBP2-47497]

Immunocytochemistry/Immunofluorescence: Cyclin L2 Antibody [NBP2-47497] - Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: Cyclin L2 Antibody [NBP2-47497]

Immunohistochemistry-Paraffin: Cyclin L2 Antibody [NBP2-47497]

Immunohistochemistry-Paraffin: Cyclin L2 Antibody [NBP2-47497] - Staining of human colon tissue. Shows strong nuclear positivity in glandular cells.
Cyclin L2 Antibody - BSA Free

Western Blot: Cyclin L2 Antibody - BSA Free [NBP2-47497] -

Phosphorylated SAMHD1 loses the ability to inhibit EV71 replicationAStable sh‐SAMHD1 HEK293T cells were transfected with VR1012, SAMHD1 WT, or the indicated mutant for 24 h and then infected with EV71 at a MOI of 0.05 for 72 h. Cells were harvested and subjected to IB analysis.BIB analysis of T592‐phosphorylated SAMHD1 and total SAMHD1 in RD and HEK293T cells.CThe effect of TRIM21 on endogenous phosphorylated SAMHD1 and total SAMHD1.DThe effect of TRIM21 on ectopic phosphorylated and unphosphorylated SAMHD1.E, FTRIM21 directly induced the degradation of SAMHD1 but not via changing cell cycle or upregulating cyclin L2 expression. (E) TRIM21 has no effect on the G0–G1 transition in MDM. (F) TRIM21 has no effect on the expression of cyclin L2 in MDM.Data information: (A–F) Tubulin served as a loading control.Source data are available online for this figure. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/31797533), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for Cyclin L2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Cyclin L2

Alternate Names

ania-6b, CCNM, cyclin L2, cyclin M, cyclin-L2, DKFZp761A1210, DKFZp762O195, HCLA-ISO, HLA-ISO, Paneth cell-enhanced expression protein, PCEE, SB138

Gene Symbol

CCNL2

Additional Cyclin L2 Products

Product Documents for Cyclin L2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Cyclin L2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Cyclin L2 Antibody - BSA Free

Customer Reviews for Cyclin L2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Cyclin L2 Antibody - BSA Free and earn rewards!

Have you used Cyclin L2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...