Cyclophilin B Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-62356

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Cyclophilin B Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to PPIB(peptidylprolyl isomerase B (cyclophilin B)) The peptide sequence was selected from the C terminal of PPIB. Peptide sequence VVFGKVLEGMEVVRKVESTKTDSRDKPLKDVIIADCGKIEVEKPFAIAKE. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Cyclophilin B Antibody - BSA Free

Western Blot: Cyclophilin B Antibody [NBP1-62356]

Western Blot: Cyclophilin B Antibody [NBP1-62356]

Western Blot: Cyclophilin B Antibody [NBP1-62356] - HepG2 cell lysate, antibody titration 1.25ug/ml. Gel concentration 12%
Immunohistochemistry-Paraffin: Cyclophilin B Antibody [NBP1-62356]

Immunohistochemistry-Paraffin: Cyclophilin B Antibody [NBP1-62356]

Immunohistochemistry-Paraffin: Cyclophilin B Antibody [NBP1-62356] - Human Liver Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Hepatocytes (indicated with arrows) 400X magnification.

Applications for Cyclophilin B Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Paraffin

1:10-1:500

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Cyclophilin B

PPIB is a cyclosporine-binding protein and is mainly located within the endoplasmic reticulum. It is associated with the secretory pathway and released in biological fluids. This protein can bind to cells derived from T- and B-lymphocytes, and may regulate cyclosporine A-mediated immunosuppression. Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests.The protein encoded by this gene is a cyclosporine-binding protein and is mainly located within the endoplasmic reticulum. It is associated with the secretory pathway and released in biological fluids. This protein can bind to cells derived from T- and B-lymphocytes, and may regulate cyclosporine A-mediated immunosuppression.

Alternate Names

CYP-S1, CYPB, PPIB, S-cyclophilin, SCYLP

Gene Symbol

PPIB

UniProt

A8K534 (Human)

Additional Cyclophilin B Products

Product Documents for Cyclophilin B Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Cyclophilin B Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Cyclophilin B Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Cyclophilin B Antibody - BSA Free and earn rewards!

Have you used Cyclophilin B Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies