CYP11B1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-68883

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Monkey

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to CYP11B1 (cytochrome P450, family 11, subfamily B, polypeptide 1) The peptide sequence was selected from the C terminal of CYP11B1. Peptide sequence ARNPNVQQALRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGL. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

55 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for CYP11B1 Antibody - BSA Free

Western Blot: CYP11B1 Antibody [NBP1-68883]

Western Blot: CYP11B1 Antibody [NBP1-68883]

Western Blot: CYP11B1 Antibody [NBP1-68883] - Titration: 0.2-1 ug/ml, Positive Control: Human Liver.
Immunohistochemistry: CYP11B1 Antibody [NBP1-68883]

Immunohistochemistry: CYP11B1 Antibody [NBP1-68883]

Immunohistochemistry: CYP11B1 Antibody [NBP1-68883] - Monkey vagina Primary Antibody Dilution: 1 : 25 Secondary Antibody: Anti-rabbit-HRP Secondary Antibody Dilution: 1 : 1000 Color/Signal Descriptions: Brown: CYP11B1 Blue: Nucleus Gene name: CYP11B1 Submitted by: Jonathan Bertin, Endoceutics Inc.
Immunohistochemistry: CYP11B1 Antibody [NBP1-68883]

Immunohistochemistry: CYP11B1 Antibody [NBP1-68883]

Immunohistochemistry: CYP11B1 Antibody [NBP1-68883] - Monkey adrenal gland Primary Antibody Dilution: 1 : 25 Secondary Antibody: Anti-rabbit-HRP Secondary Antibody Dilution: 1 : 1000 Color/Signal Descriptions: Brown: CYP11B1 Blue: Nucleus Gene name: CYP11B1 Submitted by: Jonathan Bertin, Endoceutics Inc.

Applications for CYP11B1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CYP11B1

This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the mitochondrial inner membrane and is involved in the conversion of progesterone to cortisol in the adrenal cortex. Mutations in this gene cause congenital adrenal hyperplasia due to 11-beta-hydroxylase deficiency. Transcript variants encoding different isoforms have been noted for this gene.

Long Name

Cytochrome P450 11B1, mitochondrial

Alternate Names

CYPXIB1, Cytochrome P-450c11, Cytochrome P450C11, EC 1.14.15.4, S11BH

Gene Symbol

CYP11B1

UniProt

Additional CYP11B1 Products

Product Documents for CYP11B1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CYP11B1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CYP11B1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CYP11B1 Antibody - BSA Free and earn rewards!

Have you used CYP11B1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...