Cystatin F Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-13881

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the amino acids: VKGLKYMLEVEIGRTTCKKNQHLRLDDCDFQTNHTLKQTLSCYSEVWVVPWLQHFEVPVLRCH

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Cystatin F Antibody - BSA Free

Immunohistochemistry-Paraffin: Cystatin F Antibody [NBP2-13881]

Immunohistochemistry-Paraffin: Cystatin F Antibody [NBP2-13881]

Immunohistochemistry-Paraffin: Cystatin F Antibody [NBP2-13881] - Staining in human bone marrow and skeletal muscle tissues using NBP2-13881 antibody. Corresponding CST7 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Cystatin F Antibody [NBP2-13881]

Immunohistochemistry-Paraffin: Cystatin F Antibody [NBP2-13881]

Immunohistochemistry-Paraffin: Cystatin F Antibody [NBP2-13881] - Staining of human bone marrow shows high expression.
Immunohistochemistry-Paraffin: Cystatin F Antibody [NBP2-13881]

Immunohistochemistry-Paraffin: Cystatin F Antibody [NBP2-13881]

Immunohistochemistry-Paraffin: Cystatin F Antibody [NBP2-13881] - Staining of human kidney shows no positivity in cells in tubules as expected.
Immunohistochemistry-Paraffin: Cystatin F Antibody [NBP2-13881]

Immunohistochemistry-Paraffin: Cystatin F Antibody [NBP2-13881]

Immunohistochemistry-Paraffin: Cystatin F Antibody [NBP2-13881] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: Cystatin F Antibody [NBP2-13881]

Immunohistochemistry-Paraffin: Cystatin F Antibody [NBP2-13881]

Immunohistochemistry-Paraffin: Cystatin F Antibody [NBP2-13881] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Applications for Cystatin F Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Reviewed Applications

Read 2 reviews rated 3.5 using NBP2-13881 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Cystatin F

The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the kininogens. The type 2 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of human fluids and secretions. Expression of the protein has been observed in various human cancer cell lines established from malignant tumors.

Alternate Names

CMAP, CST7, Cystatin 7, Leukocystatin

Gene Symbol

CST7

Additional Cystatin F Products

Product Documents for Cystatin F Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Cystatin F Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for Cystatin F Antibody - BSA Free (2)

3.5 out of 5
2 Customer Ratings
5 Stars
50%
4 Stars
0%
3 Stars
0%
2 Stars
50%
1 Stars
0%

Have you used Cystatin F Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Customer Images


Showing  1 - 2 of 2 reviews Showing All
Filter By:
  • Name: Anonymous
    Application: Western Blot
    Sample Tested: HEK and NK92 whole cell lysates
    Species: Human
    Verified Customer | Posted 08/10/2015
    NBP-13881 Western Blot
    Cystatin F Antibody - BSA Free NBP2-13881
  • Name: Anonymous
    Application: Immunofluorescence
    Sample Tested: HEK293 and NK92 cell lines
    Species: Human
    Verified Customer | Posted 08/10/2015
    NPB2-13881 anti-cystatin F antibody
    Cystatin F Antibody - BSA Free NBP2-13881

There are no reviews that match your criteria.

Showing  1 - 2 of 2 reviews Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...