Cytochrome c Antibody (6R10F3)

Novus Biologicals | Catalog # NBP3-16512

Recombinant Monoclonal Antibody
Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Simple Western

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 6R10F3 expressed in HEK293
View all Cytochrome c Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-105 of human Cytochrome C (P99999). MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIWGEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

12 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Cytochrome c Antibody (6R10F3)

Western Blot: Cytochrome c Antibody (6R10F3) [NBP3-16512]

Western Blot: Cytochrome c Antibody (6R10F3) [NBP3-16512]

Western Blot: Cytochrome c Antibody (6R10F3) [NBP3-16512] - Western blot analysis of extracts of various cell lines, using Cytochrome c Rabbit mAb (NBP3-16512) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.
Immunohistochemistry-Paraffin: Cytochrome c Antibody (6R10F3) [NBP3-16512]

Immunohistochemistry-Paraffin: Cytochrome c Antibody (6R10F3) [NBP3-16512]

Immunohistochemistry-Paraffin: Cytochrome c Antibody (6R10F3) [NBP3-16512] - Immunohistochemistry of paraffin-embedded human appendix using Cytochrome c Rabbit mAb (NBP3-16512) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: Cytochrome c Antibody (6R10F3) [NBP3-16512]

Immunohistochemistry-Paraffin: Cytochrome c Antibody (6R10F3) [NBP3-16512]

Immunohistochemistry-Paraffin: Cytochrome c Antibody (6R10F3) [NBP3-16512] - Immunohistochemistry of paraffin-embedded rat kidney using Cytochrome c Rabbit mAb (NBP3-16512) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Cytochrome c Antibody (6R10F3)

Immunohistochemistry: Cytochrome c Antibody (6R10F3) [NBP3-16512] -

Immunohistochemistry: Cytochrome c Antibody (6R10F3) [NBP3-16512] - Immunohistochemistry analysis of paraffin-embedded Human liver tissue using Cytochrome c Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Cytochrome c Antibody (6R10F3)

Immunohistochemistry: Cytochrome c Antibody (6R10F3) [NBP3-16512] -

Immunohistochemistry: Cytochrome c Antibody (6R10F3) [NBP3-16512] - Immunohistochemistry analysis of paraffin-embedded Human lung cancer tissue using Cytochrome c Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Cytochrome c Antibody (6R10F3)

Immunohistochemistry: Cytochrome c Antibody (6R10F3) [NBP3-16512] -

Immunohistochemistry: Cytochrome c Antibody (6R10F3) [NBP3-16512] - Immunohistochemistry analysis of paraffin-embedded Rat liver tissue using Cytochrome c Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Cytochrome c Antibody (6R10F3)

Immunohistochemistry: Cytochrome c Antibody (6R10F3) [NBP3-16512] -

Immunohistochemistry: Cytochrome c Antibody (6R10F3) [NBP3-16512] - Immunohistochemistry analysis of paraffin-embedded Mouse testis tissue using Cytochrome c Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Cytochrome c Antibody (6R10F3)

Immunohistochemistry: Cytochrome c Antibody (6R10F3) [NBP3-16512] -

Immunohistochemistry: Cytochrome c Antibody (6R10F3) [NBP3-16512] - Immunohistochemistry analysis of paraffin-embedded Mouse kidney tissue using Cytochrome c Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Applications for Cytochrome c Antibody (6R10F3)

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:1000
Application Notes
Simple Western validated by ProteinSimple, Inc.
See Simple Western Antibody Database for Simple Western validation

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Cytochrome c

In addition to its well-known role in electron-transport, cytochrome c (CYT) has been identified as a mediator of apoptosis or programmed cell death (1). Cytochrome c translocates from mitochondria into the cytoplasm in the early phases of apoptosis and plays a role in initiation of the apoptotic proteolytic cascade bay activating caspase-3 (2). Cytochrome c has been shown to bind Apaf-1. Apaf-1 has also been shown to activate capase-3 (3).

Alternate Names

CYCS

Gene Symbol

CYCS

Additional Cytochrome c Products

Product Documents for Cytochrome c Antibody (6R10F3)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Cytochrome c Antibody (6R10F3)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Bcl-2 Proteins and Regulators

Customer Reviews for Cytochrome c Antibody (6R10F3)

There are currently no reviews for this product. Be the first to review Cytochrome c Antibody (6R10F3) and earn rewards!

Have you used Cytochrome c Antibody (6R10F3)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies