Cytochrome P450 3A5 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-68885

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Cytochrome P450 3A5 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to CYP3A5 (cytochrome P450, family 3, subfamily A, polypeptide 5) The peptide sequence was selected from the N terminal of CYP3A5. Peptide sequence AITDPDVIRTVLVKECYSVFTNRRSLGPVGFMKSAISLAEDEEWKRIRSL. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

57 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Cytochrome P450 3A5 Antibody - BSA Free

Western Blot: Cytochrome P450 3A5 Antibody [NBP1-68885]

Western Blot: Cytochrome P450 3A5 Antibody [NBP1-68885]

Western Blot: Cytochrome P450 3A5 Antibody [NBP1-68885] - Titration: 0.2-1 ug/ml, Positive Control: Human Placenta.
Immunohistochemistry: Cytochrome P450 3A5 Antibody [NBP1-68885]

Immunohistochemistry: Cytochrome P450 3A5 Antibody [NBP1-68885]

Immunohistochemistry: Cytochrome P450 3A5 Antibody [NBP1-68885] - Human Adult Small intestine Observed Staining: Cytoplasm in hepatocytes Primary Antibody Concentration: 1 : 600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1 : 200 Magnification: 20X Exposure Time: 0.5 2.0 sec.

Applications for Cytochrome P450 3A5 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Reviewed Applications

Read 1 review rated 3 using NBP1-68885 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Cytochrome P450 3A5

This gene,CYP3A5, encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and its expression is induced by glucocorticoids and some pharmacological agents. The enzyme metabolizes drugs such as nifedipine and cyclosporine as well as the steroid hormones testosterone, progesterone and androstenedione. This gene is part of a cluster of cytochrome P450 genes on chromosome 7q21.1. This cluster includes a pseudogene, CYP3A5P1, which is very similar to CYP3A5. This similarity has caused some difficulty in determining whether cloned sequences represent the gene or the pseudogene. Multiple alternatively spliced transcript variants have been identified for this gene.

Long Name

Cytochrome P450 3A5

Alternate Names

CYP3A5, CYPIIIA5

Gene Symbol

CYP3A5

UniProt

P51589 (Human)

Additional Cytochrome P450 3A5 Products

Product Documents for Cytochrome P450 3A5 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Cytochrome P450 3A5 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Cytochrome P450 3A5 Antibody - BSA Free (1)

3 out of 5
1 Customer Rating
5 Stars
0%
4 Stars
0%
3 Stars
100%
2 Stars
0%
1 Stars
0%

Have you used Cytochrome P450 3A5 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images

Showing  1 - 1 of 1 review Showing All
Filter By:
Clear Filters X
  • Cytochrome P450 3A5 Antibody
    Name: Dahao Ling
    Application: Simple Western
    Sample Tested: Human Liver Tissue
    Species: Rabbit
    Verified Customer | Posted 11/07/2019
    Lanes 22 and 23 are two samples (AAL1 and AAL80) of Human Liver tissue (African America) of two different genotypes. The two lanes were blotted with NBP1-68885 and detected using HRP method. Dilution are 1:10.
    On Jess from Protein Simple.
    Cytochrome P450 3A5 Antibody - BSA Free NBP1-68885

There are no reviews that match your criteria.

Showing  1 - 1 of 1 review Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies