Cytokeratin 13 Antibody (5M6B10)
Novus Biologicals | Catalog # NBP3-15261
Recombinant Monoclonal Antibody
![Western Blot: Cytokeratin 13 Antibody (5M6B10) [NBP3-15261]](https://resources.rndsystems.com/images/products/Cytokeratin-13-Antibody-5M6B10-Western-Blot-NBP3-15261-img0005.jpg "Western Blot: Cytokeratin 13 Antibody (5M6B10) [NBP3-15261]")
Loading...
Key Product Details
Species Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Recombinant Monoclonal Rabbit IgG Clone # 5M6B10 expressed in HEK293
Loading...
Product Specifications
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 100-200 of human Cytokeratin 13 (P13646). LTGNEKITMQNLNDRLASYLEKVRALEEANADLEVKIRDWHLKQSPASPERDYSPYYKTIEELRDKILTATIENNRVILEIDNARLAADDFRLKYENELAL
Clonality
Monoclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for Cytokeratin 13 Antibody (5M6B10)
Western Blot: Cytokeratin 13 Antibody (5M6B10) [NBP3-15261]
Western Blot: Cytokeratin 13 Antibody (5M6B10) [NBP3-15261] - Western blot analysis of extracts of various cell lines, using Cytokeratin 13 (KRT13) Rabbit mAb (NBP3-15261) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.![Immunocytochemistry/ Immunofluorescence: Cytokeratin 13 Antibody (5M6B10) [NBP3-15261]](https://resources.rndsystems.com/images/products/Cytokeratin-13-Antibody-5M6B10-Immunocytochemistry-Immunofluorescence-NBP3-15261-img0003.jpg "Immunocytochemistry/ Immunofluorescence: Cytokeratin 13 Antibody (5M6B10) [NBP3-15261]")
Immunocytochemistry/ Immunofluorescence: Cytokeratin 13 Antibody (5M6B10) [NBP3-15261]
Immunocytochemistry/Immunofluorescence: Cytokeratin 13 Antibody (5M6B10) [NBP3-15261] - Immunofluorescence analysis of human cervix cancer using Cytokeratin 13 (KRT13) Rabbit mAb (NBP3-15261) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.![Immunohistochemistry: Cytokeratin 13 Antibody (5M6B10) [NBP3-15261]](https://resources.rndsystems.com/images/products/Cytokeratin-13-Antibody-5M6B10-Immunohistochemistry-NBP3-15261-img0004.jpg "Immunohistochemistry: Cytokeratin 13 Antibody (5M6B10) [NBP3-15261]")
Immunohistochemistry: Cytokeratin 13 Antibody (5M6B10) [NBP3-15261]
Immunohistochemistry: Cytokeratin 13 Antibody (5M6B10) [NBP3-15261] - Immunofluorescence analysis of mouse bladder using Cytokeratin 13 (KRT13) Rabbit mAb (NBP3-15261) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.![Immunohistochemistry-Paraffin: Cytokeratin 13 Antibody (5M6B10) [NBP3-15261]](https://resources.rndsystems.com/images/products/Cytokeratin-13-Antibody-5M6B10-Immunohistochemistry-Paraffin-NBP3-15261-img0001.jpg "Immunohistochemistry-Paraffin: Cytokeratin 13 Antibody (5M6B10) [NBP3-15261]")
Immunohistochemistry-Paraffin: Cytokeratin 13 Antibody (5M6B10) [NBP3-15261]
Immunohistochemistry-Paraffin: Cytokeratin 13 Antibody (5M6B10) [NBP3-15261] - Immunohistochemistry of paraffin-embedded human lung squamous carcinoma tissue using Cytokeratin 13 (KRT13) Rabbit mAb (NBP3-15261) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.![Immunohistochemistry: Cytokeratin 13 Antibody (5M6B10) [NBP3-15261]](https://resources.rndsystems.com/images/products/Cytokeratin-13-Antibody-5M6B10-Immunohistochemistry-NBP3-15261-img0002.jpg "Immunohistochemistry: Cytokeratin 13 Antibody (5M6B10) [NBP3-15261]")
Immunohistochemistry: Cytokeratin 13 Antibody (5M6B10) [NBP3-15261]
Immunohistochemistry: Cytokeratin 13 Antibody (5M6B10) [NBP3-15261] - Immunofluorescence analysis of rat bladder using Cytokeratin 13 (KRT13) Rabbit mAb (NBP3-15261) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunohistochemistry: Cytokeratin 13 Antibody (5M6B10) [Cytokeratin 13] -
Immunohistochemistry: Cytokeratin 13 Antibody (5M6B10) [Cytokeratin 13] - Immunohistochemistry analysis of paraffin-embedded Human esophagus tissue using Cytokeratin 13 Rabbit mAb at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry: Cytokeratin 13 Antibody (5M6B10) [Cytokeratin 13] -
Immunohistochemistry: Cytokeratin 13 Antibody (5M6B10) [Cytokeratin 13] - Immunohistochemistry analysis of paraffin-embedded Human tonsil tissue using Cytokeratin 13 Rabbit mAb at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.Applications for Cytokeratin 13 Antibody (5M6B10)
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
1:50 - 1:200
Immunohistochemistry
1:50 - 1:200
Western Blot
1:500 - 1:2000
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol, 0.05% BSA
Preservative
0.02% Sodium Azide
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: Cytokeratin 13
Alternate Names
CK13, CK-13, cytokeratin 13, Cytokeratin-13, K13cytokeratin-13, keratin 13, keratin, type I cytoskeletal 13, keratin-13, MGC161462, MGC3781
Gene Symbol
KRT13
Additional Cytokeratin 13 Products
Product Documents for Cytokeratin 13 Antibody (5M6B10)
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Cytokeratin 13 Antibody (5M6B10)
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for Cytokeratin 13 Antibody (5M6B10)
There are currently no reviews for this product. Be the first to review Cytokeratin 13 Antibody (5M6B10) and earn rewards!
Have you used Cytokeratin 13 Antibody (5M6B10)?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...