Cytokeratin 20 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-85599

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Cited:

Human, Mouse

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Cited:

Western Blot, IF/IHC

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: MDFSRRSFHRSLSSSLQAPVVSTVGMQRLGTTPSVYGGAGGRGIRISNSRHTVNYGSDLTGGGDLFVGNEKMAMQNLND

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 30522949).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

48 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Cytokeratin 20 Antibody - BSA Free

Immunohistochemistry-Paraffin: Cytokeratin 20 Antibody [NBP1-85599]

Immunohistochemistry-Paraffin: Cytokeratin 20 Antibody [NBP1-85599]

Immunohistochemistry-Paraffin: Cytokeratin 20 Antibody [NBP1-85599] - Staining of human liver shows no positivity in hepatocytes as expected
Immunohistochemistry-Paraffin: Cytokeratin 20 Antibody [NBP1-85599]

Immunohistochemistry-Paraffin: Cytokeratin 20 Antibody [NBP1-85599]

Immunohistochemistry-Paraffin: Cytokeratin 20 Antibody [NBP1-85599] - Staining of human stomach shows moderate to strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: Cytokeratin 20 Antibody [NBP1-85599]

Immunohistochemistry-Paraffin: Cytokeratin 20 Antibody [NBP1-85599]

Immunohistochemistry-Paraffin: Cytokeratin 20 Antibody [NBP1-85599] - Staining of colon shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: Cytokeratin 20 Antibody [NBP1-85599]

Immunohistochemistry-Paraffin: Cytokeratin 20 Antibody [NBP1-85599]

Immunohistochemistry-Paraffin: Cytokeratin 20 Antibody [NBP1-85599] - Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.
Cytokeratin 20 Antibody - BSA Free Western Blot: Cytokeratin 20 Antibody - BSA Free [NBP1-85599]

Western Blot: Cytokeratin 20 Antibody - BSA Free [NBP1-85599]

Analysis in human small intestine tissue.
Cytokeratin 20 Antibody - BSA Free Immunohistochemistry-Paraffin: Cytokeratin 20 Antibody - BSA Free [NBP1-85599]

Immunohistochemistry-Paraffin: Cytokeratin 20 Antibody - BSA Free [NBP1-85599]

Immunohistochemistry analysis in human small intestine and liver tissues using HPA024309 antibody. Corresponding KRT20 RNA-seq data are presented for the same tissues.

Applications for Cytokeratin 20 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 -1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Cytokeratin 20

Intermediate-sized filament (IF) protein designated cytokeratin (CK) 1 is a major cellular protein of mature enterocytes and goblet cells commonly found in mucosal epithelium of the mammalian gastrointestinal tract (1). Results strongly suggest that transcriptional regulation of keratin genes in the intestinal epithelium occurs at the level of both immature and terminally differentiated epithelial cells, and is tightly regulated during both fetal development and crypt-to-villus differentiation of the intestinal epithelium (2). CK20 has recently been reported to be useful to distinguish between primary and metastatic lung adenocarcinoma. CK20 expression was significantly more prevalent in adenocarcinoma that originated in the GI tract than that of pulmonary or breast origin (3).

Alternate Names

CD20, CK20, CK-20, cytokeratin-20, K20cytokeratin 20, keratin 20, keratin, type I cytoskeletal 20, keratin-20, KRT21, MGC35423, Protein IT

Entrez Gene IDs

54474 (Human)

Gene Symbol

KRT20

UniProt

Additional Cytokeratin 20 Products

Product Documents for Cytokeratin 20 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Cytokeratin 20 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Cytokeratin 20 Antibody - BSA Free

Customer Reviews for Cytokeratin 20 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Cytokeratin 20 Antibody - BSA Free and earn rewards!

Have you used Cytokeratin 20 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...