Cytokeratin 6 Antibody (3F7A1)
Novus Biologicals | Catalog # NBP3-15324
Recombinant Monoclonal Antibody
![Western Blot: Cytokeratin 6 Antibody (3F7A1) [NBP3-15324]](https://resources.rndsystems.com/images/products/Cytokeratin-6-Antibody-3F7A1-Western-Blot-NBP3-15324-img0002.jpg "Western Blot: Cytokeratin 6 Antibody (3F7A1) [NBP3-15324]")
Loading...
Key Product Details
Species Reactivity
Human
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot
Label
Unconjugated
Antibody Source
Recombinant Monoclonal Rabbit IgG Clone # 3F7A1 expressed in HEK293
Loading...
Product Specifications
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 465-564 of human Cytokeratin 6 (P48668). YRKLLEGEECRLNGEGVGQVNVSVVQSTISSGYGGASGVGSGLGLGGGSSYSYGSGLGIGGGFSSSSGRAIGGGLSSVGGGSSTIKYTTTSSSSRKSYKH
Clonality
Monoclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for Cytokeratin 6 Antibody (3F7A1)
Western Blot: Cytokeratin 6 Antibody (3F7A1) [NBP3-15324]
Western Blot: Cytokeratin 6 Antibody (3F7A1) [NBP3-15324] - Western blot analysis of extracts of various cell lines, using Cytokeratin 6 (KRT6) Rabbit mAb (NBP3-15324) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.![Immunohistochemistry-Paraffin: Cytokeratin 6 Antibody (3F7A1) [NBP3-15324]](https://resources.rndsystems.com/images/products/Cytokeratin-6-Antibody-3F7A1-Immunohistochemistry-Paraffin-NBP3-15324-img0001.jpg "Immunohistochemistry-Paraffin: Cytokeratin 6 Antibody (3F7A1) [NBP3-15324]")
Immunohistochemistry-Paraffin: Cytokeratin 6 Antibody (3F7A1) [NBP3-15324]
Immunohistochemistry-Paraffin: Cytokeratin 6 Antibody (3F7A1) [NBP3-15324] - Immunohistochemistry of paraffin-embedded human esophageal using Cytokeratin 6 (KRT6) Rabbit mAb (NBP3-15324) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.Applications for Cytokeratin 6 Antibody (3F7A1)
Application
Recommended Usage
Immunohistochemistry
1:50 - 1:200
Western Blot
1:500 - 1:2000
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol, 0.05% BSA
Preservative
0.02% Sodium Azide
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: Cytokeratin 6
Alternate Names
Allergen Hom s 5, CK6A, CK-6A, CK6C, CK6D, CK-6D, cytokeratin 6A, cytokeratin 6C, cytokeratin 6D, Cytokeratin-6A, Cytokeratin-6D, K6A, K6C, K6D, keratin 6A, keratin 6C, keratin 6D, keratin, epidermal type II, K6A, keratin, type II cytoskeletal 6A, Keratin-6A, KRT6C, KRT6D, Type-II keratin Kb6
Gene Symbol
KRT6A
Additional Cytokeratin 6 Products
Product Documents for Cytokeratin 6 Antibody (3F7A1)
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Cytokeratin 6 Antibody (3F7A1)
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for Cytokeratin 6 Antibody (3F7A1)
There are currently no reviews for this product. Be the first to review Cytokeratin 6 Antibody (3F7A1) and earn rewards!
Have you used Cytokeratin 6 Antibody (3F7A1)?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...