Cytokeratin 6a Antibody (1T4Z8)

Novus Biologicals | Catalog # NBP3-16452

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 1T4Z8 expressed in HEK293
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Cytokeratin 6a (P02538). MASTSTTIRSHSSSRRGFSANSARLPGVSRSGFSSVSVSRSRGSGGLGGACGGAGFGSRSLYGLGGSKRISIGGGSCAISGGYGSRAGGSYGFGGAGSGF

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Cytokeratin 6a Antibody (1T4Z8)

Western Blot: Cytokeratin 6a Antibody (1T4Z8) [NBP3-16452]

Western Blot: Cytokeratin 6a Antibody (1T4Z8) [NBP3-16452]

Western Blot: Cytokeratin 6a Antibody (1T4Z8) [NBP3-16452] - Western blot analysis of extracts of various cell lines, using Cytokeratin 6a (KRT6) Rabbit mAb (NBP3-16452) at 1:3000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.
Immunohistochemistry-Paraffin: Cytokeratin 6a Antibody (1T4Z8) [NBP3-16452]

Immunohistochemistry-Paraffin: Cytokeratin 6a Antibody (1T4Z8) [NBP3-16452]

Immunohistochemistry-Paraffin: Cytokeratin 6a Antibody (1T4Z8) [NBP3-16452] - Immunohistochemistry of paraffin-embedded human esophageal cancer using Cytokeratin 6a (KRT6) Rabbit mAb (NBP3-16452) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Applications for Cytokeratin 6a Antibody (1T4Z8)

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Western Blot

1:1000 - 1:5000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Cytokeratin 6a

The human type II Cytokeratin 6 (CK6; 56 kDa) is expressed in a heterogeneous array of epithelial tissues under normal conditions, but is better known for its strong induction in stratified epithelia that feature an enhanced cell proliferation rate or abnormal differentiation. It has been demonstrated that CK6 isoform, CK6a, is clearly the dominant CK6 isoform in skin tissue samples and cultured epithelial cell lines and that the various isoforms are differentially regulated within and between epithelial tissue types (1). The murine genome is known to have two keratin 6 (CK6) genes, mouse CK6, CK6a and MK6b. These genes display a complex expression pattern with constitutive expression in the epithelia of oral mucosa, hair follicles, and nail beds (2). Pachyonychia congenital (PC) is characterized by hypertrophic nail dystrophy and associated ectodermal features. PC-1 subtype is associated with mutations in keratins 6a or 16, whereas PC-2 subtype is linked to mutations in keratins 6b or 17 (3).

Alternate Names

Allergen Hom s 5, CK6A, CK-6A, CK6C, CK6D, CK-6D, cytokeratin 6A, cytokeratin 6C, cytokeratin 6D, Cytokeratin-6A, Cytokeratin-6D, K6A, K6C, K6D, keratin 6A, keratin 6C, keratin 6D, keratin, epidermal type II, K6A, keratin, type II cytoskeletal 6A, Keratin-6A, KRT6C, KRT6D, Type-II keratin Kb6

Gene Symbol

KRT6A

Additional Cytokeratin 6a Products

Product Documents for Cytokeratin 6a Antibody (1T4Z8)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Cytokeratin 6a Antibody (1T4Z8)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Cytokeratin 6a Antibody (1T4Z8)

There are currently no reviews for this product. Be the first to review Cytokeratin 6a Antibody (1T4Z8) and earn rewards!

Have you used Cytokeratin 6a Antibody (1T4Z8)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...