Cytosolic Sulfotransferase 2B1/SULT2B1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-16997

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (93%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Cytosolic Sulfotransferase 2B1/SULT2B1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: KAKVIYMGRNPRDVVVSLYHYSKIAGQLKDPGTPDQFLRDFLKGEVQFGSWFDH

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Cytosolic Sulfotransferase 2B1/SULT2B1 Antibody - BSA Free

Western Blot: Cytosolic Sulfotransferase 2B1/SULT2B1 Antibody [NBP3-16997]

Western Blot: Cytosolic Sulfotransferase 2B1/SULT2B1 Antibody [NBP3-16997]

Western Blot: Cytosolic Sulfotransferase 2B1/SULT2B1 Antibody [NBP3-16997] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10; Lane 2: RT4; Lane 3: U-251 MG; Lane 4: Human Plasma; Lane 5: Liver; Lane 6: Tonsil
Immunohistochemistry-Paraffin: Cytosolic Sulfotransferase 2B1/SULT2B1 Antibody [NBP3-16997]

Immunohistochemistry-Paraffin: Cytosolic Sulfotransferase 2B1/SULT2B1 Antibody [NBP3-16997]

Immunohistochemistry-Paraffin: Cytosolic Sulfotransferase 2B1/SULT2B1 Antibody [NBP3-16997] - Staining of human rectum shows low expression as expected.
Immunohistochemistry-Paraffin: Cytosolic Sulfotransferase 2B1/SULT2B1 Antibody [NBP3-16997]

Immunohistochemistry-Paraffin: Cytosolic Sulfotransferase 2B1/SULT2B1 Antibody [NBP3-16997]

Immunohistochemistry-Paraffin: Cytosolic Sulfotransferase 2B1/SULT2B1 Antibody [NBP3-16997] - Analysis in human esophagus and rectum tissues using Anti-SULT2B1 antibody. Corresponding SULT2B1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Cytosolic Sulfotransferase 2B1/SULT2B1 Antibody [NBP3-16997]

Immunohistochemistry-Paraffin: Cytosolic Sulfotransferase 2B1/SULT2B1 Antibody [NBP3-16997]

Immunohistochemistry-Paraffin: Cytosolic Sulfotransferase 2B1/SULT2B1 Antibody [NBP3-16997] - Staining of human esophagus shows high expression.

Applications for Cytosolic Sulfotransferase 2B1/SULT2B1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Cytosolic Sulfotransferase 2B1/SULT2B1

Sulfotransferase family cytosolic 2B member 1 isoform b, also known as SULT2B1, is a member of Sulfotransferase family. Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. SULT2B1b is localized in the cytosol and nuclei of human cells. SULT2B1b is selective for the sulfation of 3beta-hydroxysteroids such as dehydroepiandrosterone and pregnenolone, and may also have a role in cholesterol sulfation in human skin. Recombinant human SULT2B1, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.

Alternate Names

HSST2, SULT2B1

Gene Symbol

SULT2B1

Additional Cytosolic Sulfotransferase 2B1/SULT2B1 Products

Product Documents for Cytosolic Sulfotransferase 2B1/SULT2B1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Cytosolic Sulfotransferase 2B1/SULT2B1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Sulfation Regulators

Customer Reviews for Cytosolic Sulfotransferase 2B1/SULT2B1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Cytosolic Sulfotransferase 2B1/SULT2B1 Antibody - BSA Free and earn rewards!

Have you used Cytosolic Sulfotransferase 2B1/SULT2B1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies