DAP5 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-85311

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Knockout/Knockdown, Independent Antibodies

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Knockdown Validated

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all DAP5 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: QDTVELREHHWVPRKAFLDNGPKTINQIRQDAVKDLGVFIPAPMAQGMRSDFFLEGPFMPPRMKMDRDPLGGLADMFGQMPGSGIGTGPGVIQDRFSPTMGRHRSNQLFNGHGGHIMPPTQSQFGEMGGKFMKSQGLSQLYH

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for DAP5 Antibody - BSA Free

Western Blot: DAP5 Antibody [NBP1-85311]

Western Blot: DAP5 Antibody [NBP1-85311]

Western Blot: DAP5 Antibody [NBP1-85311] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-EIF4G2 antibody. Remaining relative intensity is presented.
Western Blot: DAP5 Antibody [NBP1-85311]

Western Blot: DAP5 Antibody [NBP1-85311]

Western Blot: DAP5 Antibody [NBP1-85311] - Analysis using Anti-EIF4G2 antibody NBP1-85311 (A) shows similar pattern to independent antibody NBP1-85310 (B).
Immunocytochemistry/ Immunofluorescence: DAP5 Antibody [NBP1-85311]

Immunocytochemistry/ Immunofluorescence: DAP5 Antibody [NBP1-85311]

Immunocytochemistry/Immunofluorescence: DAP5 Antibody [NBP1-85311] - Staining of human cell line U-2 OS shows positivity in cytoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: DAP5 Antibody [NBP1-85311]

Immunohistochemistry-Paraffin: DAP5 Antibody [NBP1-85311]

Immunohistochemistry-Paraffin: DAP5 Antibody [NBP1-85311] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.
Western Blot: DAP5 Antibody [NBP1-85311]

Western Blot: DAP5 Antibody [NBP1-85311]

Western Blot: DAP5 Antibody [NBP1-85311] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: DAP5 Antibody [NBP1-85311]

Immunohistochemistry-Paraffin: DAP5 Antibody [NBP1-85311]

Immunohistochemistry-Paraffin: DAP5 Antibody [NBP1-85311] - Staining of human gastrointestinal shows moderate to strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: DAP5 Antibody [NBP1-85311]

Immunohistochemistry-Paraffin: DAP5 Antibody [NBP1-85311]

Immunohistochemistry-Paraffin: DAP5 Antibody [NBP1-85311] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: DAP5 Antibody [NBP1-85311]

Immunohistochemistry-Paraffin: DAP5 Antibody [NBP1-85311]

Immunohistochemistry-Paraffin: DAP5 Antibody [NBP1-85311] - Staining of human skeletal muscle shows no positivity in myocytes.

Applications for DAP5 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DAP5

Translation initiation is mediated by specific recognition of the cap structure by eukaryotic translation initiation factor 4F (eIF4F), which is a cap binding protein complex that consists of three subunits: eIF4A, eIF4E and eIF4G. The protein encoded by this gene shares similarity with the C-terminal region of eIF4G that contains the binding sites for eIF4A and eIF3; eIF4G, in addition, contains a binding site for eIF4E at the N-terminus. Unlike eIF4G, which supports cap-dependent and independent translation, this gene product functions as a general repressor of translation by forming translationally inactive complexes. In vitro and in vivo studies indicate that translation of this mRNA initiates exclusively at a non-AUG (GUG) codon. Alternatively spliced transcript variants encoding different isoforms of this gene have been described.

Alternate Names

aging-associated protein 1, DAP-5, DAP5AAG1, Death-associated protein 5, eIF4G 2, eIF-4G 2, eIF-4-gamma 2, eukaryotic translation initiation factor 4 gamma 2, eukaryotic translation initiation factor 4 gamma, 2, eukaryotic translation initiation factor 4G-like 1, FLJ41344, NAT1, P97

Gene Symbol

EIF4G2

Additional DAP5 Products

Product Documents for DAP5 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for DAP5 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for DAP5 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DAP5 Antibody - BSA Free and earn rewards!

Have you used DAP5 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies