DARPP-32 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-33534

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Rat (91%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all DARPP-32 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: PTPAMLFRLSEHSSPEEEASPHQRASGEGHHLKSKRPNPCAYTPPSLKAVQRIAESHLQSISNLNENQASEEEDE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for DARPP-32 Antibody - BSA Free

Western Blot: DARPP-32 Antibody [NBP2-33534]

Western Blot: DARPP-32 Antibody [NBP2-33534]

Western Blot: DARPP-32 Antibody [NBP2-33534] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10
Lane 2: Human Cerebral Cortex tissue
Immunohistochemistry: DARPP-32 Antibody [NBP2-33534]

Immunohistochemistry: DARPP-32 Antibody [NBP2-33534]

Immunohistochemistry: DARPP-32 Antibody [NBP2-33534] - Staining of mouse olfactory bulb shows immunoreactivity in a subset of neurons.
Immunohistochemistry-Paraffin: DARPP-32 Antibody [NBP2-33534]

Immunohistochemistry-Paraffin: DARPP-32 Antibody [NBP2-33534]

Immunohistochemistry-Paraffin: DARPP-32 Antibody [NBP2-33534] - Immunohistochemical staining of human kidney shows strong membranous positivity in cells in tubules.
Immunohistochemistry-Paraffin: DARPP-32 Antibody [NBP2-33534]

Immunohistochemistry-Paraffin: DARPP-32 Antibody [NBP2-33534]

Immunohistochemistry-Paraffin: DARPP-32 Antibody [NBP2-33534] - Staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cells.
Immunohistochemistry-Paraffin: DARPP-32 Antibody [NBP2-33534]

Immunohistochemistry-Paraffin: DARPP-32 Antibody [NBP2-33534]

Immunohistochemistry-Paraffin: DARPP-32 Antibody [NBP2-33534] - Staining of human cerebellum shows positivity in Purkinje cells and cells in molecular layer.
Immunohistochemistry: DARPP-32 Antibody [NBP2-33534]

Immunohistochemistry: DARPP-32 Antibody [NBP2-33534]

Immunohistochemistry: DARPP-32 Antibody [NBP2-33534] - Staining of mouse cerebellum shows positivity in all the layers.
Immunohistochemistry: DARPP-32 Antibody [NBP2-33534]

Immunohistochemistry: DARPP-32 Antibody [NBP2-33534]

Immunohistochemistry: DARPP-32 Antibody [NBP2-33534] - Staining of mouse hippocampus shows positivity in neurons.
Immunohistochemistry: DARPP-32 Antibody [NBP2-33534]

Immunohistochemistry: DARPP-32 Antibody [NBP2-33534]

Immunohistochemistry: DARPP-32 Antibody [NBP2-33534] - Staining of mouse motor trigeminal nucleus shows immunoreactivity in neuronal cell bodies.
Immunohistochemistry: DARPP-32 Antibody [NBP2-33534]

Immunohistochemistry: DARPP-32 Antibody [NBP2-33534]

Immunohistochemistry: DARPP-32 Antibody [NBP2-33534] - Staining of mouse visual cortex shows neuronal immunoreactivity.

Applications for DARPP-32 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DARPP-32

DARPP-32, a dopamine (DA) and cAMP-regulated ~32k phosphoprotein, is associated with dopaminoceptive neurons bearing D-1 receptors in the basal ganglia. The protein inhibits protein phosphatase I when it is phosphorylated on Thr34. In contrast, when DARPP-32 is phosphorylated on Thr75 the protein acts as an inhibitor of PKA. Phosphorylation of DARPP is thought to play a critical role in the regulation of dopaminergic neurotransmission. In addition, the activity of DARPP-32 is also thought to play important roles in the actions of alcohol, caffeine and Prozac

Long Name

Dopamine and cAMP-regulated Phosphoprotein

Alternate Names

DARPP32, PPP1R1B

Gene Symbol

PPP1R1B

UniProt

Q9UD71 (Human)

Additional DARPP-32 Products

Product Documents for DARPP-32 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for DARPP-32 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Phosphatases and Regulators

Customer Reviews for DARPP-32 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DARPP-32 Antibody - BSA Free and earn rewards!

Have you used DARPP-32 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies