DAZAP1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-82740

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all DAZAP1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: STTQETLRSYFSQYGEVVDCVIMKDKTTNQSRGFGFVKFKDPNCVGTVLASRPHTLDGRNIDPKPCTPRGMQPERTRPKEGWQKGPRSDNSKSNKIFVGGIPHNCGETELREYFKKFGVVTEVVMIYDAEKQRPR

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for DAZAP1 Antibody - BSA Free

Western Blot: DAZAP1 Antibody [NBP1-82740]

Western Blot: DAZAP1 Antibody [NBP1-82740]

Western Blot: DAZAP1 Antibody [NBP1-82740] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells), Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Immunocytochemistry/ Immunofluorescence: DAZAP1 Antibody [NBP1-82740]

Immunocytochemistry/ Immunofluorescence: DAZAP1 Antibody [NBP1-82740]

Immunocytochemistry/Immunofluorescence: DAZAP1 Antibody [NBP1-82740] - Staining of human cell line A-431 shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: DAZAP1 Antibody [NBP1-82740]

Immunohistochemistry-Paraffin: DAZAP1 Antibody [NBP1-82740]

Immunohistochemistry-Paraffin: DAZAP1 Antibody [NBP1-82740] - Staining in human testis and liver tissues using NBP1-82740 antibody. Corresponding DAZAP1 RNA-seq data are presented for the same tissues.
Western Blot: DAZAP1 Antibody [NBP1-82740]

Western Blot: DAZAP1 Antibody [NBP1-82740]

Western Blot: DAZAP1 Antibody [NBP1-82740] - Lane 1: Marker [kDa] 230, 110, 82, 49, 32, 26, 18. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: DAZAP1 Antibody [NBP1-82740]

Immunohistochemistry-Paraffin: DAZAP1 Antibody [NBP1-82740]

Immunohistochemistry-Paraffin: DAZAP1 Antibody [NBP1-82740] - Staining of human cerebral cortex shows moderate nuclear positivity in neurons.
Immunohistochemistry-Paraffin: DAZAP1 Antibody [NBP1-82740]

Immunohistochemistry-Paraffin: DAZAP1 Antibody [NBP1-82740]

Immunohistochemistry-Paraffin: DAZAP1 Antibody [NBP1-82740] - Staining of human cerebral cortex, liver, skin and testis using Anti-DAZAP1 antibody NBP1-82740 (A) shows similar protein distribution across tissues to independent antibody NBP1-82741 (B).
Immunohistochemistry-Paraffin: DAZAP1 Antibody [NBP1-82740]

Immunohistochemistry-Paraffin: DAZAP1 Antibody [NBP1-82740]

Immunohistochemistry-Paraffin: DAZAP1 Antibody [NBP1-82740] - Staining of human liver shows no weak positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: DAZAP1 Antibody [NBP1-82740]

Immunohistochemistry-Paraffin: DAZAP1 Antibody [NBP1-82740]

Immunohistochemistry-Paraffin: DAZAP1 Antibody [NBP1-82740] - Staining of human skin shows moderate to strong nuclear positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: DAZAP1 Antibody [NBP1-82740]

Immunohistochemistry-Paraffin: DAZAP1 Antibody [NBP1-82740]

Immunohistochemistry-Paraffin: DAZAP1 Antibody [NBP1-82740] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.

Applications for DAZAP1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DAZAP1

In mammals, the Y chromosome directs the development of the testes and plays an important role in spermatogenesis. A high percentage of infertile men have deletions that map to regions of the Y chromosome. The DAZ (deleted in azoospermia) gene cluster maps to the AZFc region of the Y chromosome and is deleted in many azoospermic and severely oligospermic men. It is thought that the DAZ gene cluster arose from the transposition, amplification, and pruning of the ancestral autosomal gene DAZL also involved in germ cell development and gametogenesis. This gene encodes a RNA-binding protein with two RNP motifs that was originally identified by its interaction with the infertility factors DAZ and DAZL. Two isoforms are encoded by transcript variants of this gene.

Alternate Names

DAZ associated protein 1, DAZ-associated protein 1, deleted in azoospermia associated protein 1, Deleted in azoospermia-associated protein 1, MGC19907

Gene Symbol

DAZAP1

Additional DAZAP1 Products

Product Documents for DAZAP1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for DAZAP1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for DAZAP1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DAZAP1 Antibody - BSA Free and earn rewards!

Have you used DAZAP1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies