DCI Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-91822
![Immunohistochemistry-Paraffin: DCI Antibody [NBP1-91822]](https://resources.rndsystems.com/images/products/DCI-Antibody-Immunohistochemistry-Paraffin-NBP1-91822-img0014.jpg "Immunohistochemistry-Paraffin: DCI Antibody [NBP1-91822]")
Loading...
Key Product Details
Validated by
Orthogonal Validation, Independent Antibodies
Species Reactivity
Validated:
Human
Cited:
Human
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot
Cited:
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: FGSQRVLVEPDAGAGVAVMKFKNPPVNSLSLEFLTELVISLEKLENDKSFRGVILTSDRPGVFSAGLDLTEMCGRS
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Rat (80%)
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for DCI Antibody - BSA Free
![Immunohistochemistry-Paraffin: DCI Antibody [NBP1-91822]](https://resources.rndsystems.com/images/products/DCI-Antibody-Immunohistochemistry-Paraffin-NBP1-91822-img0006.jpg "Immunohistochemistry-Paraffin: DCI Antibody [NBP1-91822]")
Immunohistochemistry-Paraffin: DCI Antibody [NBP1-91822]
Immunohistochemistry-Paraffin: DCI Antibody [NBP1-91822] - Staining of human cerebral cortex, kidney, liver and testis using Anti-ECI1 antibody NBP1-91822 (A) shows similar protein distribution across tissues to independent antibody NBP1-91821 (B).![Western Blot: DCI Antibody [NBP1-91822]](https://resources.rndsystems.com/images/products/DCI-Antibody-Western-Blot-NBP1-91822-img0012.jpg "Western Blot: DCI Antibody [NBP1-91822]")
![Immunohistochemistry-Paraffin: DCI Antibody [NBP1-91822]](https://resources.rndsystems.com/images/products/DCI-Antibody-Immunohistochemistry-Paraffin-NBP1-91822-img0018.jpg "Immunohistochemistry-Paraffin: DCI Antibody [NBP1-91822]")
Immunohistochemistry-Paraffin: DCI Antibody [NBP1-91822]
Immunohistochemistry-Paraffin: DCI Antibody [NBP1-91822] - Staining of human tonsil shows very weak granular ctyoplasmic positivity in germinal center cells.![Immunohistochemistry-Paraffin: DCI Antibody [NBP1-91822]](https://resources.rndsystems.com/images/products/DCI-Antibody-Immunohistochemistry-Paraffin-NBP1-91822-img0015.jpg "Immunohistochemistry-Paraffin: DCI Antibody [NBP1-91822]")
Immunohistochemistry-Paraffin: DCI Antibody [NBP1-91822]
Immunohistochemistry-Paraffin: DCI Antibody [NBP1-91822] - Staining of human small intestine shows strong granular cytoplasmic positivity in glandular cells.![Immunohistochemistry-Paraffin: DCI Antibody [NBP1-91822]](https://resources.rndsystems.com/images/products/DCI-Antibody-Immunohistochemistry-Paraffin-NBP1-91822-img0016.jpg "Immunohistochemistry-Paraffin: DCI Antibody [NBP1-91822]")
Immunohistochemistry-Paraffin: DCI Antibody [NBP1-91822]
Immunohistochemistry-Paraffin: DCI Antibody [NBP1-91822] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.![Immunohistochemistry-Paraffin: DCI Antibody [NBP1-91822]](https://resources.rndsystems.com/images/products/DCI-Antibody-Immunohistochemistry-Paraffin-NBP1-91822-img0017.jpg "Immunohistochemistry-Paraffin: DCI Antibody [NBP1-91822]")
Immunohistochemistry-Paraffin: DCI Antibody [NBP1-91822]
Immunohistochemistry-Paraffin: DCI Antibody [NBP1-91822] - Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.![DCI Antibody - BSA Free Immunohistochemistry: DCI Antibody - BSA Free [NBP1-91822]](https://resources.rndsystems.com/images/products/nbp1-91822_rabbit-polyclonal-dci-antibody-3052025749524.jpg "Immunohistochemistry: DCI Antibody - BSA Free [NBP1-91822]")
Immunohistochemistry: DCI Antibody - BSA Free [NBP1-91822]
Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.![DCI Antibody - BSA Free Immunohistochemistry: DCI Antibody - BSA Free [NBP1-91822]](https://resources.rndsystems.com/images/products/nbp1-91822_rabbit-polyclonal-dci-antibody-30520251052514.jpg "Immunohistochemistry: DCI Antibody - BSA Free [NBP1-91822]")
Immunohistochemistry: DCI Antibody - BSA Free [NBP1-91822]
Staining of human duodenum).![DCI Antibody - BSA Free Immunohistochemistry: DCI Antibody - BSA Free [NBP1-91822]](https://resources.rndsystems.com/images/products/nbp1-91822_rabbit-polyclonal-dci-antibody-295202516445713.jpg "Immunohistochemistry: DCI Antibody - BSA Free [NBP1-91822]")
Immunohistochemistry: DCI Antibody - BSA Free [NBP1-91822]
Staining of human tonsil shows very weak granular cytoplasmic positivity in germinal center cells.![DCI Antibody - BSA Free Immunohistochemistry: DCI Antibody - BSA Free [NBP1-91822]](https://resources.rndsystems.com/images/products/nbp1-91822_rabbit-polyclonal-dci-antibody-29520251613310.jpg "Immunohistochemistry: DCI Antibody - BSA Free [NBP1-91822]")
![DCI Antibody - BSA Free Immunohistochemistry: DCI Antibody - BSA Free [NBP1-91822]](https://resources.rndsystems.com/images/products/nbp1-91822_rabbit-polyclonal-dci-antibody-3052025723420.jpg "Immunohistochemistry: DCI Antibody - BSA Free [NBP1-91822]")
Immunohistochemistry: DCI Antibody - BSA Free [NBP1-91822]
Staining of human small intestine shows strong granular cytoplasmic positivity in glandular cells.![DCI Antibody - BSA Free Immunohistochemistry: DCI Antibody - BSA Free [NBP1-91822]](https://resources.rndsystems.com/images/products/nbp1-91822_rabbit-polyclonal-dci-antibody-2952025167113.jpg "Immunohistochemistry: DCI Antibody - BSA Free [NBP1-91822]")
Immunohistochemistry: DCI Antibody - BSA Free [NBP1-91822]
Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.Applications for DCI Antibody - BSA Free
Application
Recommended Usage
Immunohistochemistry
1:50 - 1:200
Immunohistochemistry-Paraffin
1:50-1:200
Western Blot
0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: DCI
Alternate Names
acetylene-allene isomerase, D2-enoyl-CoA isomerase, D3, DCI3,2-trans-enoyl-CoA isomerase3,2 trans-enoyl-CoA isomerase, Delta(2)-enoyl-CoA isomerase, Delta(3), delta3, delta2-enoyl-CoA isomerase, dodecenoyl-CoA delta isomerase (3,2 trans-enoyl-CoA isomerase), dodecenoyl-CoA isomerase3,2-trans-enoyl-CoA isomerase, mitochondrial, dodecenoyl-Coenzyme A delta isomerase (3,2 trans-enoyl-Coenzyme A isomerase), EC 5.3.3.8, enoyl-CoA delta isomerase 13,2 trans-enoyl-Coenzyme A isomerase
Gene Symbol
ECI1
Additional DCI Products
Product Documents for DCI Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for DCI Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for DCI Antibody - BSA Free
Powered by Bioz
Customer Reviews for DCI Antibody - BSA Free
There are currently no reviews for this product. Be the first to review DCI Antibody - BSA Free and earn rewards!
Have you used DCI Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...