Dcp1a Antibody (3G4) - Azide and BSA Free

Novus Biologicals | Catalog # H00055802-M06

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human, Mouse, Rat, Insect

Cited:

Human, Mouse

Applications

Validated:

Immunohistochemistry, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation, Proximity Ligation Assay

Cited:

Western Blot, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 3G4

Format

Azide and BSA Free
View all Dcp1a Primary Antibodies »

Product Specifications

Immunogen

DCP1A (NP_060873, 186 a.a. ~ 285 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. STQLSNLGSTETLEEMPSGSQDKSAPSGHKHLTVEELFGTSLPKEQPAVVGLDSEEMERLPGDASQKEPNSFLPFPFEQLGGAPQSETLGVPSAAHHSVQ

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 25530357).

Specificity

DCP1A - DCP1 decapping enzyme homolog A (S. cerevisiae)

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Scientific Data Images for Dcp1a Antibody (3G4) - Azide and BSA Free

Western Blot: Dcp1a Antibody (3G4) [H00055802-M06]

Western Blot: Dcp1a Antibody (3G4) [H00055802-M06]

Western Blot: Dcp1a Antibody (3G4) [H00055802-M06] - Western Blot analysis of DCP1A expression in IMR-32 ( Cat # L008V1 ).
Immunocytochemistry/ Immunofluorescence: Dcp1a Antibody (3G4) [H00055802-M06]

Immunocytochemistry/ Immunofluorescence: Dcp1a Antibody (3G4) [H00055802-M06]

Dcp1a-Antibody-3G4-Immunocytochemistry-Immunofluorescence-H00055802-M06-img0011.jpg
Immunocytochemistry/ Immunofluorescence: Dcp1a Antibody (3G4) [H00055802-M06]

Immunocytochemistry/ Immunofluorescence: Dcp1a Antibody (3G4) [H00055802-M06]

Immunocytochemistry/Immunofluorescence: Dcp1a Antibody (3G4) [H00055802-M06] - Analysis of monoclonal antibody to DCP1A on HeLa cell. Antibody concentration 10 ug/ml
Immunocytochemistry/ Immunofluorescence: Dcp1a Antibody (3G4) [H00055802-M06]

Immunocytochemistry/ Immunofluorescence: Dcp1a Antibody (3G4) [H00055802-M06]

Dcp1a-Antibody-3G4-Immunocytochemistry-Immunofluorescence-H00055802-M06-img0008.jpg
Immunocytochemistry/ Immunofluorescence: Dcp1a Antibody (3G4) [H00055802-M06]

Immunocytochemistry/ Immunofluorescence: Dcp1a Antibody (3G4) [H00055802-M06]

Dcp1a-Antibody-3G4-Immunocytochemistry-Immunofluorescence-H00055802-M06-img0009.jpg
Immunocytochemistry/ Immunofluorescence: Dcp1a Antibody (3G4) [H00055802-M06]

Immunocytochemistry/ Immunofluorescence: Dcp1a Antibody (3G4) [H00055802-M06]

Dcp1a-Antibody-3G4-Immunocytochemistry-Immunofluorescence-H00055802-M06-img0010.jpg
Immunocytochemistry/ Immunofluorescence: Dcp1a Antibody (3G4) [H00055802-M06]

Immunocytochemistry/ Immunofluorescence: Dcp1a Antibody (3G4) [H00055802-M06]

Dcp1a-Antibody-3G4-Immunocytochemistry-Immunofluorescence-H00055802-M06-img0012.jpg
ELISA: Dcp1a Antibody (3G4) [H00055802-M06]

ELISA: Dcp1a Antibody (3G4) [H00055802-M06]

ELISA: Dcp1a Antibody (3G4) [H00055802-M06] - Detection limit for recombinant GST tagged DCP1A is approximately 0.1ng/ml as a capture antibody.
Dcp1a Antibody (3G4)

Immunocytochemistry/ Immunofluorescence: Dcp1a Antibody (3G4) [H00055802-M06] -

Immunocytochemistry/ Immunofluorescence: Dcp1a Antibody (3G4) [H00055802-M06] - OTUD4 is recruited to stress granules. (A) Immunofluorescence of OTUD4 (shown in red) in SH-SY5Y cells that were either untreated, arsenite-treated (30 min, 0.5 mM) or heat-shocked (42°C, 1 h). Cells were co-stained for the stress granule marker protein TIA1 (green) & DAPI as a nuclear marker (blue). OTUD4 is redistributed to granular structures upon arsenite & heat-shock treatment. Granules also contain TIA1 & are considered as stress granules. Scale bar: 20 µm. The experiment was repeated two times. (B) Exogenously expressed FLAG–OTUD4 is recruited to stress granules in HeLa cells. Transfected cells were arsenite-treated (0.5 mM) for 40 min or left untreated & co-stained with anti-FLAG (red) & anti-G3BP1 antibodies (green). Nuclei are shown in blue (DAPI). Scale bar: 20 µm. The experiment was done at least three times. (C) OTUD4 granules do not colocalize with P-bodies. Shown is immunofluorescence of HeLa cells (untreated or 0.5 mM arsenite for 30 min) stained with anti-OTUD4 (red) & anti-DCP1a (green) antibodies. Scale bar: 20 µm. The experiment was performed two times. (D) OTUD4 granules contain mRNA. HeLa cells were treated with arsenite (0.5 mM) for 1 h. FISH was carried out with Cy3-labeled oligo(dT) (red), & cells were co-stained with anti-OTUD4 (shown in green). Scale bar: 20 µm. A representative image from four independent experiments is shown. (E) Scheme illustrating OTUD4 fragments used in F, numbers indicate amino acid borders of expression constructs. IDR, intrinsically disordered region. (F) HeLa cells were transfected with EGFP-tagged OTUD4 expression constructs as shown in E) & treated with arsenite (0.5 mM for 30 min) or left untreated to monitor intrinsic ability to form granules. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/31138677), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
Dcp1a Antibody (3G4) - Azide and BSA Free

Western Blot: Dcp1a Antibody (3G4) - Azide and BSA Free [H00055802-M06] -

Coronavirus infection does not alter steady state levels of most processing body proteins.A. HUVECs were transduced with human ACE2 (HUVECACE2), selected, and infected with SARS-CoV-2 TO-1 isolate (MOI = 3). Cells were lysed at 6 and 12 hours post infection and immunoblotting was performed using XRN1, Hedls, DCP1A, DDX6, SARS-CoV-2 N, and beta -actin specific antibodies. One representative experiment of two is shown. B-C. HUVECs were infected with OC43 (B, TCID50 = 2 x 104) or 229E (C, TCID50 = 2.4 x 103). Cells were lysed at 12 and 24 hours post infection (B, OC43) or 6 and 12 hours post infection (C, 229E). Immunoblotting was performed using XRN1, Hedls, DCP1A, DDX6, OC43 N protein (B only), and beta -actin specific antibodies. One representative experiment of three is shown. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/35998203), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
Dcp1a Antibody (3G4) - Azide and BSA Free

Western Blot: Dcp1a Antibody (3G4) - Azide and BSA Free [H00055802-M06] -

Processing body disassembly is not a common feature of all human coronavirus N proteins.A-D. HUVECs were transduced with recombinant lentiviruses ectopically expressing N protein from the Betacoronaviruses MERS-CoV and OC43 (A-B) or N protein from Alphacoronaviruses 229E and NL63 (C-D) or N protein from SARS-CoV-1 (E-F). A control lentiviral expressing an empty vector (EV) was used as a negative control and SARS-CoV-2 N protein expressing lentiviruses were used as a positive control in each experiment. Cells were selected, fixed and immunostained for DDX6 (PBs; white; Alexa555) and either authentic N protein or a FLAG tag (green; Alexa488). Nuclei were stained with Hoechst (blue). Scale bar = 20 μm. DDX6 puncta in EV or N-transduced cells were quantified using CellProfiler as in Fig 1. DDX6 puncta were quantified as in Fig 1. Representative images from one independent experiment of three are shown. These data represent three independent biological replicates (n = 3) with >30 cells measured per condition (EV and N) per replicate. Each EV and N replicate pair plotted independently; mean. Statistics were performed using Kruskal-Wallis H test with Dunn’s correction (*, p < 0.0332; **, p < 0.0021; ****, p < 0.0001; ns, nonsignificant). G-I. HUVECs were transduced as above, protein lysate was harvested and immunoblotting was performed using XRN1, Hedls, DCP1A, DDX6, N protein or FLAG, and beta -actin specific antibodies. One representative experiment of three is shown. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/35998203), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
Dcp1a Antibody (3G4) - Azide and BSA Free

Western Blot: Dcp1a Antibody (3G4) - Azide and BSA Free [H00055802-M06] -

Processing body disassembly is not a common feature of all human coronavirus N proteins.A-D. HUVECs were transduced with recombinant lentiviruses ectopically expressing N protein from the Betacoronaviruses MERS-CoV and OC43 (A-B) or N protein from Alphacoronaviruses 229E and NL63 (C-D) or N protein from SARS-CoV-1 (E-F). A control lentiviral expressing an empty vector (EV) was used as a negative control and SARS-CoV-2 N protein expressing lentiviruses were used as a positive control in each experiment. Cells were selected, fixed and immunostained for DDX6 (PBs; white; Alexa555) and either authentic N protein or a FLAG tag (green; Alexa488). Nuclei were stained with Hoechst (blue). Scale bar = 20 μm. DDX6 puncta in EV or N-transduced cells were quantified using CellProfiler as in Fig 1. DDX6 puncta were quantified as in Fig 1. Representative images from one independent experiment of three are shown. These data represent three independent biological replicates (n = 3) with >30 cells measured per condition (EV and N) per replicate. Each EV and N replicate pair plotted independently; mean. Statistics were performed using Kruskal-Wallis H test with Dunn’s correction (*, p < 0.0332; **, p < 0.0021; ****, p < 0.0001; ns, nonsignificant). G-I. HUVECs were transduced as above, protein lysate was harvested and immunoblotting was performed using XRN1, Hedls, DCP1A, DDX6, N protein or FLAG, and beta -actin specific antibodies. One representative experiment of three is shown. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/35998203), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
Dcp1a Antibody (3G4) - Azide and BSA Free

Western Blot: Dcp1a Antibody (3G4) - Azide and BSA Free [H00055802-M06] -

Coronavirus infection does not alter steady state levels of most processing body proteins.A. HUVECs were transduced with human ACE2 (HUVECACE2), selected, and infected with SARS-CoV-2 TO-1 isolate (MOI = 3). Cells were lysed at 6 and 12 hours post infection and immunoblotting was performed using XRN1, Hedls, DCP1A, DDX6, SARS-CoV-2 N, and beta -actin specific antibodies. One representative experiment of two is shown. B-C. HUVECs were infected with OC43 (B, TCID50 = 2 x 104) or 229E (C, TCID50 = 2.4 x 103). Cells were lysed at 12 and 24 hours post infection (B, OC43) or 6 and 12 hours post infection (C, 229E). Immunoblotting was performed using XRN1, Hedls, DCP1A, DDX6, OC43 N protein (B only), and beta -actin specific antibodies. One representative experiment of three is shown. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/35998203), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
Dcp1a Antibody (3G4) - Azide and BSA Free

Western Blot: Dcp1a Antibody (3G4) - Azide and BSA Free [H00055802-M06] -

Coronavirus infection does not alter steady state levels of most processing body proteins.A. HUVECs were transduced with human ACE2 (HUVECACE2), selected, and infected with SARS-CoV-2 TO-1 isolate (MOI = 3). Cells were lysed at 6 and 12 hours post infection and immunoblotting was performed using XRN1, Hedls, DCP1A, DDX6, SARS-CoV-2 N, and beta -actin specific antibodies. One representative experiment of two is shown. B-C. HUVECs were infected with OC43 (B, TCID50 = 2 x 104) or 229E (C, TCID50 = 2.4 x 103). Cells were lysed at 12 and 24 hours post infection (B, OC43) or 6 and 12 hours post infection (C, 229E). Immunoblotting was performed using XRN1, Hedls, DCP1A, DDX6, OC43 N protein (B only), and beta -actin specific antibodies. One representative experiment of three is shown. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/35998203), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for Dcp1a Antibody (3G4) - Azide and BSA Free

Application
Recommended Usage

ELISA

1:100-1:2000

Immunocytochemistry/ Immunofluorescence

1:10-1:2000

Western Blot

1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence and ELISA. Use in immunprecipitation reported in scientific literature (PMID 21883093)

Reviewed Applications

Read 1 review rated 5 using H00055802-M06 in the following applications:

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: Dcp1a

Decapping is a key step in general and regulated mRNA decay. The protein encoded by this gene is a decapping enzyme. This protein and another decapping enzyme form a decapping complex, which interacts with the nonsense-mediated decay factor hUpf1 and may be recruited to mRNAs containing premature termination codons. This protein also participates in the TGF-beta signaling pathway.

Alternate Names

DCP1 decapping enzyme homolog A (S. cerevisiae), decapping enzyme hDcp1a, EC 3.-, FLJ21691, mRNA-decapping enzyme 1A, Nbla00360, putative protein product of Nbla00360, Smad4-interacting transcriptional co-activator, SMAD4IP1, SMIFHSA275986, Transcription factor SMIF

Entrez Gene IDs

55802 (Human)

Gene Symbol

DCP1A

OMIM

607010 (Human)

UniProt

NP_060873 (Human)

Additional Dcp1a Products

Product Documents for Dcp1a Antibody (3G4) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Dcp1a Antibody (3G4) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Dcp1a Antibody (3G4) - Azide and BSA Free

Customer Reviews for Dcp1a Antibody (3G4) - Azide and BSA Free (1)

5 out of 5
1 Customer Rating
5 Stars
100%
4 Stars
0%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used Dcp1a Antibody (3G4) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images

Showing  1 - 1 of 1 review Showing All
Filter By:
Clear Filters X
  • Dcp1a Antibody (3G4)
    Name: Anonymous
    Application: Immunocytochemistry
    Sample Tested: RAW264.7 cells
    Species: Mus Musculus
    Verified Customer | Posted 03/16/2018
    Dcp1a enriched in P bodies of RAW cell lines..
    IF analysis of Dcp1a protein with antibody at 1:100 dilution in RAW cell lines using a Nikon Widefield Fluorescence microscope
    Dcp1a Antibody (3G4) - Azide and BSA Free H00055802-M06

There are no reviews that match your criteria.

Showing  1 - 1 of 1 review Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies