DDAH2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-58859

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all DDAH2 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to DDAH2 (dimethylarginine dimethylaminohydrolase 2). The peptide sequence was selected from the N-terminal of DDAH2 (NP_039268). Peptide sequence MGTPGEGLGRCSHALIRGVPESLASGEGAGAGLPALDLAKAQREHGVLGG. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for DDAH2 Antibody - BSA Free

Western Blot: DDAH2 Antibody [NBP1-58859]

Western Blot: DDAH2 Antibody [NBP1-58859]

Western Blot: DDAH2 Antibody [NBP1-58859] - Titration: 1 ug/ml Positive Control: Fetal Brain Lysate.
Immunohistochemistry-Paraffin: DDAH2 Antibody [NBP1-58859]

Immunohistochemistry-Paraffin: DDAH2 Antibody [NBP1-58859]

Immunohistochemistry-Paraffin: DDAH2 Antibody [NBP1-58859] - Human Uterus Tissue, 5.0ug/ml.
Immunohistochemistry-Paraffin: DDAH2 Antibody [NBP1-58859]

Immunohistochemistry-Paraffin: DDAH2 Antibody [NBP1-58859]

Immunohistochemistry-Paraffin: DDAH2 Antibody [NBP1-58859] - Human Uterus.
Immunohistochemistry-Paraffin: DDAH2 Antibody [NBP1-58859]

Immunohistochemistry-Paraffin: DDAH2 Antibody [NBP1-58859]

Immunohistochemistry-Paraffin: DDAH2 Antibody [NBP1-58859] - Human Uterus.

Applications for DDAH2 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Paraffin

1:10-1:500

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DDAH2

DDAH2 hydrolyzes N(G),N(G)-dimethyl-L-arginine (ADMA) and N(G)-monomethyl-L-arginine (MMA) which act as inhibitors of NOS. DDAH2 has therefore a role in nitric oxide generation.This gene belongs to the dimethylarginine dimethylaminohydrolase (DDAH) gene family. The encoded enzyme plays a role in nitric oxide generation by regulating cellular concentrations of methylarginines, which in turn inhibit nitric oxide synthase activity. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Alternate Names

DDAHII, dimethylargininase-2, dimethylarginine dimethylaminohydrolase 2G6a, dimethylarginine dimethylaminohydrolase II, EC 3.5.3.18, G6A, N(G), N(G)-dimethylarginine dimethylaminohydrolase 2, NG30, NG-dimethylarginine dimethylamino hydrolase homolog, S-phase protein

Entrez Gene IDs

23564 (Human)

Gene Symbol

DDAH2

UniProt

O95865 (Human)

Additional DDAH2 Products

Product Documents for DDAH2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for DDAH2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for DDAH2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DDAH2 Antibody - BSA Free and earn rewards!

Have you used DDAH2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for DDAH2 Antibody - BSA Free

Showing  1 - 1 of 1 FAQ Showing All

  • Q: I ran a blast on the immunogen sequence used to raise the antibody (cat# NBP1-58859) and the sequence has been identified as coiled-coil domain-containing protein 54. Are you sure about your information? The blot looks good on the datasheet but I am not confident with it.

    A: This is a mistake on our website and I have confirmed with the lab that this antibody is, in fact, specific for DDHA2.

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Antibodies